General Information of the Protein
| Protein ID |
PT02347
|
||||
|---|---|---|---|---|---|
| Protein Name |
Tumor necrosis factor
|
||||
| Secondarily Protein Name |
Cachectin
TNF-alpha
Tumor necrosis factor ligand superfamily member 2
N-terminal fragment
|
||||
| Gene Name |
TNF
|
||||
| Secondarily Gene Name |
TNFA
TNFSF2
|
||||
| Sequence |
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Show/Hide
|
||||
| Organism |
Homo sapiens, Human
|
||||
| Protein Classification |
Secreted protein
|
||||
| Function |
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs regulatory T-cells (Treg) function in individuals with rheumatoid arthritis via FOXP3 dephosphorylation. Up-regulates the expression of protein phosphatase 1 (PP1), which dephosphorylates the key 'Ser-418' residue of FOXP3, thereby inactivating FOXP3 and rendering Treg cells functionally defective (PubMed:23396208). Key mediator of cell death in the anticancer action of BCG-stimulated neutrophils in combination with DIABLO/SMAC mimetic in the RT4v6 bladder cancer cell line (PubMed:22517918, PubMed:16829952, PubMed:23396208). Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance (By similarity). Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6 (PubMed:12794819). Promotes osteoclastogenesis and therefore mediates bone resorption (By similarity).
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Subcellular Location |
Cell membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000025 , HEK-293T
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Tumor necrosis factor (TNF) )
| Target Type | Successful Target | ||||
|---|---|---|---|---|---|
| Disease | 7 Target-related Diseases | 7 | |||
| 1 | Multiple myeloma [ICD-11: 2A83] | ||||
| 2 | Pancreatitis [ICD-11: DC31-DC34] | ||||
| 3 | Intermittent claudication [ICD-11: BD40.00] | ||||
| 4 | Influenza virus infection [ICD-11: 1E30-1E32] | ||||
| 5 | Diffuse systemic sclerosis [ICD-11: 4A42.1] | ||||
| 6 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | ||||
| 7 | Motor neurone disease [ICD-11: 8B60] | ||||
| Approved Drug(s) | 4 Approved Drugs | 4 | |||
| 1 | Lenalidomide | Approved | |||
| 2 | Nafamostat | Approved | |||
| 3 | Pentoxifylline | Approved | |||
| 4 | Thalidomide | Approved | |||
| Clinical Trial Drug(s) | 3 Clinical Trial Drugs | 3 | |||
| 1 | BAICALEIN | Phase 2 | |||
| 2 | CPL-7075 | Phase 3 | |||
| 3 | Ortataxel | Phase 2 | |||
| Preclinical Drug(s) | 1 Preclinical Drug | 1 | |||
| 1 | Celastrol | Preclinical | |||
Target 2 ( TNFA messenger RNA (TNF mRNA) )
| Target Type | Discontinued Target | ||||
|---|---|---|---|---|---|
| Disease | 1 Target-related Disease | 1 | |||
| 1 | Schizophrenia [ICD-11: 6A20] | ||||
| Discontinued Drug(s) | 1 Discontinued Drug | 1 | |||
| 1 | PNU-282987 | Terminated | |||
Target 3 ( HUMAN tumor necrosis factor (TNF) )
| Target Type | Unknown Type Target | ||||
|---|---|---|---|---|---|