General Information of the Protein
| Protein ID |
PT03120
|
||||
|---|---|---|---|---|---|
| Protein Name |
Cytochrome P450 11B2, mitochondrial
|
||||
| Secondarily Protein Name |
Aldosterone synthase
Aldosterone-synthesizing enzyme
CYPXIB2
Corticosterone 18-monooxygenase
CYP11B2
Cytochrome P-450Aldo
Cytochrome P-450C18
Steroid 11-beta-hydroxylase
CYP11B2
Steroid 18-hydroxylase
|
||||
| Gene Name |
CYP11B2
|
||||
| Sequence |
MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN
Show/Hide
|
||||
| Organism |
Homo sapiens, Human
|
||||
| Protein Classification |
Enzyme
>
Cytochrome P450
>
Cytochrome P450 family 11
>
Cytochrome P450 family 11B
>
Cytochrome P450 11B2
|
||||
| Function |
A cytochrome P450 monooxygenase that catalyzes the biosynthesis of aldosterone, the main mineralocorticoid in the human body responsible for salt and water homeostasis, thus involved in blood pressure regulation, arterial hypertension, and the development of heart failure (PubMed:1775135, PubMed:1518866, PubMed:9814482, PubMed:15356073, PubMed:12530636, PubMed:22446688, PubMed:11856349, PubMed:23322723, PubMed:1594605, PubMed:9814506). Catalyzes three sequential oxidative reactions of 11-deoxycorticosterone (21-hydroxyprogesterone), namely 11-beta hydroxylation, followed by two successive oxidations at C18 yielding 18-hydroxy and then 18-oxo intermediates (that would not leave the enzyme active site during the consecutive hydroxylation reactions), ending with the formation of aldosterone (PubMed:1775135, PubMed:1518866, PubMed:12530636, PubMed:22446688, PubMed:11856349, PubMed:23322723, PubMed:1594605, PubMed:9814506). Can also produce 18-hydroxycortisol and 18-oxocortisol, derived from successive oxidations of cortisol at C18, normally found at very low levels, but significantly increased in primary aldosteronism, the most common form of secondary hypertension (PubMed:15356073, PubMed:9814482). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate and reducing the second into a water molecule. Two electrons are provided by NADPH via a two-protein mitochondrial transfer system comprising flavoprotein FDXR (adrenodoxin/ferredoxin reductase) and nonheme iron-sulfur protein FDX1 or FDX2 (adrenodoxin/ferredoxin) (PubMed:11856349, PubMed:1594605, PubMed:23322723, PubMed:9814506). Could also be involved in the androgen metabolic pathway (Probable).
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Subcellular Location |
Mitochondrion inner membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000405 , G-402
Cell Line ID: CL000050 , HEK293-A
Cell Line ID: CL000263 , NCI-H295R
Cell Line ID: CL000191 , V79
Cell Line ID: CL000170 , V79MZ
Cell Line ID: CL000193 , V79MZh11B2
Biochemical Assays
Clinical Information about the Protein
Similar Protein(s) and Bioactivity Statistics
50% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT02875 | Cytochrome P450 11B1, mitochondrial | Rattus norvegicus, Rat | |
|---|---|---|---|
| PT03119 | Cytochrome P450 11B1, mitochondrial | Homo sapiens, Human | |
| PT04507 | Cytochrome P450 11B2, mitochondrial | Rattus norvegicus, Rat | |
| PT06518 | Cytochrome P450 11B2, mitochondrial | Mus musculus, Mouse | |