General Information of the Protein
| Protein ID |
PT02896
|
||||
|---|---|---|---|---|---|
| Protein Name |
Tryptophan 2,3-dioxygenase
|
||||
| Secondarily Protein Name |
Tryptamin 2,3-dioxygenase
Tryptophan oxygenase
Tryptophan pyrrolase
Tryptophanase
|
||||
| Gene Name |
TDO2
|
||||
| Secondarily Gene Name |
TDO
|
||||
| Sequence |
MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD
Show/Hide
|
||||
| Organism |
Homo sapiens, Human
|
||||
| Protein Classification |
Enzyme
>
Oxidoreductase
|
||||
| Function |
Heme-dependent dioxygenase that catalyzes the oxidative cleavage of the L-tryptophan (L-Trp) pyrrole ring and converts L-tryptophan to N-formyl-L-kynurenine. Catalyzes the oxidative cleavage of the indole moiety.
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Ensembl ID | |||||
| HGNC ID | |||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000438 , A-172
Cell Line ID: CL000026 , CHO-K1
Cell Line ID: CL000006 , HEK293
Cell Line ID: CL000154 , HEK293-EBNA1-6E
Cell Line ID: CL000784 , P815B
Cell Line ID: CL000518 , SW48
Cell Line ID: CL000015 , SW480
Cell Line ID: CL000102 , U-87MG ATCC
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Tryptophan 2,3-dioxygenase (TDO) )
| Target Type | Clinical trial Target | ||||
|---|---|---|---|---|---|
| Disease | 1 Target-related Disease | 1 | |||
| 1 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | ||||
| Preclinical Drug(s) | 3 Preclinical Drugs | 3 | |||
| 1 | 4-(4-fluoropyrazol-1-yl)-1,2-oxazol-5-amine | Preclinical | |||
| 2 | 680C91 | Preclinical | |||
| 3 | LM10 | Preclinical | |||
Similar Protein(s) and Bioactivity Statistics
50% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT05447 | Tryptophan 2,3-dioxygenase | Mus musculus, Mouse | |
|---|---|---|---|