General Information of the Protein
Protein ID |
PT04881
|
||||
---|---|---|---|---|---|
Protein Name |
Folate receptor alpha
|
||||
Secondarily Protein Name |
Adult folate-binding protein
Folate receptor 1
Folate receptor
adult
KB cells FBP
Ovarian tumor-associated antigen MOv18
|
||||
Gene Name |
FOLR1
|
||||
Secondarily Gene Name |
FOLR
|
||||
Sequence |
MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Show/Hide
|
||||
Organism |
Homo sapiens, Human
|
||||
Protein Classification |
Membrane receptor
|
||||
Function |
Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells (PubMed:23851396, PubMed:23934049, PubMed:2527252, PubMed:8033114, PubMed:8567728, PubMed:19074442). Has high affinity for folate and folic acid analogs at neutral pH (PubMed:23851396, PubMed:23934049, PubMed:2527252, PubMed:8033114, PubMed:8567728). Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release (PubMed:8567728). Required for normal embryonic development and normal cell proliferation (By similarity).
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
HGNC ID | |||||
Subcellular Location |
Cell membrane
Apical cell membrane
Basolateral cell membrane
Secreted
Cytoplasmic vesicle
Cytoplasmic vesicle
Clathrin-coated vesicle
Endosome
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000938 , Chinese hamster RT16
Cell Line ID: CL000330 , CHO Pro-4 MtxRII OuaR-2-4
Clinical Information about the Protein
Target 1 ( Folate receptor alpha (FOLR1) )
Target Type | Successful Target | ||||
---|---|---|---|---|---|
Disease | 2 Target-related Diseases | 2 | |||
1 | Malaria [ICD-11: 1F40-1F45] | ||||
2 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | ||||
Approved Drug(s) | 1 Approved Drug | 1 | |||
1 | Pyrimethamine | Approved | |||
Clinical Trial Drug(s) | 1 Clinical Trial Drug | 1 | |||
1 | Talotrexin | Phase 1/2 |