General Information of the Protein
| Protein ID |
PT04880
|
||||
|---|---|---|---|---|---|
| Protein Name |
Nuclear receptor subfamily 1 group I member 2
|
||||
| Secondarily Protein Name |
Orphan nuclear receptor PXR
Pregnane X receptor
|
||||
| Gene Name |
NR1I2
|
||||
| Secondarily Gene Name |
Pxr
|
||||
| Sequence |
MRPEERWNHVGLVQREEADSVLEEPINVDEEDGGLQICRVCGDKANGYHFNVMTCEGCKGFFRRAMKRNVRLRCPFRKGTCEITRKTRRQCQACRLRKCLESGMKKEMIMSDAAVEQRRALIKRKKREKIEAPPPGGQGLTEEQQALIQELMDAQMQTFDTTFSHFKDFRLPAVFHSDCELPEVLQASLLEDPATWSQIMKDSVPMKISVQLRGEDGSIWNYQPPSKSDGKEIIPLLPHLADVSTYMFKGVINFAKVISHFRELPIEDQISLLKGATFEMCILRFNTMFDTETGTWECGRLAYCFEDPNGGFQKLLLDPLMKFHCMLKKLQLREEEYVLMQAISLFSPDRPGVVQRSVVDQLQERFALTLKAYIECSRPYPAHRFLFLKIMAVLTELRSINAQQTQQLLRIQDTHPFATPLMQELFSSTDG
Show/Hide
|
||||
| Organism |
Rattus norvegicus, Rat
|
||||
| Protein Classification |
Transcription factor
>
Nuclear receptor
>
Nuclear hormone receptor subfamily 1
>
Nuclear hormone receptor subfamily 1 group I
>
Nuclear hormone receptor subfamily 1 group I member 2
|
||||
| Function |
Nuclear receptor that binds and is activated by a variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, endogenous compounds and drugs. Response to specific ligands is species-specific, due to differences in the ligand-binding domain. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes (By similarity).
Show/Hide
|
||||
| Uniprot ID | |||||
| Subcellular Location |
Nucleus
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000063 , Hep-G2
Similar Protein(s) and Bioactivity Statistics
50% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT01552 | Nuclear receptor subfamily 1 group I member 2 | Homo sapiens, Human | |
|---|---|---|---|