General Information of the Protein
Protein ID |
PT02536
|
||||
---|---|---|---|---|---|
Protein Name |
Diacylglycerol O-acyltransferase 1
|
||||
Secondarily Protein Name |
ACAT-related gene product 1
Acyl-CoA retinol O-fatty-acyltransferase
Diglyceride acyltransferase
|
||||
Gene Name |
DGAT1
|
||||
Secondarily Gene Name |
AGRP1
DGAT
|
||||
Sequence |
MGDRGSSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDVGAAGDAPAPAPNKDGDAGVGSGHWELRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQVVSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPAAVVLLVESITPVGSLLALMAHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREFYRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLNYEAPAAEA
Show/Hide
|
||||
Organism |
Homo sapiens, Human
|
||||
Protein Classification |
Enzyme
>
Transferase
|
||||
Function |
Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates (PubMed:16214399, PubMed:18768481, PubMed:28420705, PubMed:9756920, PubMed:32433611, PubMed:32433610). Highly expressed in epithelial cells of the small intestine and its activity is essential for the absorption of dietary fats (PubMed:18768481). In liver, plays a role in esterifying exogenous fatty acids to glycerol, and is required to synthesize fat for storage (PubMed:16214399). Also present in female mammary glands, where it produces fat in the milk (By similarity). May be involved in VLDL (very low density lipoprotein) assembly (PubMed:18768481). In contrast to DGAT2 it is not essential for survival (By similarity). Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders (PubMed:16214399). Exhibits additional acyltransferase activities, includin acyl CoA:monoacylglycerol acyltransferase (MGAT), wax monoester and wax diester synthases (By similarity). Also able to use 1-monoalkylglycerol (1-MAkG) as an acyl acceptor for the synthesis of monoalkyl-monoacylglycerol (MAMAG) (PubMed:28420705).
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
Ensembl ID | |||||
HGNC ID | |||||
Subcellular Location |
Endoplasmic reticulum membrane
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000034 , Caco-2
Cell Line ID: CL000801 , Chang Liver
Cell Line ID: CL000026 , CHO-K1
Cell Line ID: CL000273 , Hep 3B2.1-7
Cell Line ID: CL000007 , HT-29
Cell Line ID: CL000492 , HuTu 80
Cell Line ID: CL000012 , Sf21
Cell Line ID: CL000013 , Sf9
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Diacylglycerol acyltransferase 1 (DGAT1) )
Target Type | Successful Target | ||||
---|---|---|---|---|---|
Disease | 1 Target-related Disease | 1 | |||
1 | High blood cholesterol level [ICD-11: 5C80.00] | ||||
Approved Drug(s) | 1 Approved Drug | 1 | |||
1 | Hesperetin | Approved |
Target 2 ( DGAT1 messenger RNA (DGAT1 mRNA) )
Target Type | Literature-reported Target |
---|
Similar Protein(s) and Bioactivity Statistics
50% Identity
Protein ID | Protein Name | Protein Organism | |
PT02560 | Diacylglycerol O-acyltransferase 1 | Mus musculus, Mouse |
---|