General Information of the Protein
Protein ID |
PT01276
|
||||
---|---|---|---|---|---|
Protein Name |
Collagenase 3
|
||||
Secondarily Protein Name |
Matrix metalloproteinase-13
|
||||
Gene Name |
MMP13
|
||||
Sequence |
MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Show/Hide
|
||||
Organism |
Homo sapiens, Human
|
||||
Protein Classification |
Enzyme
>
Protease
>
Metallo protease
>
Metallo protease MAM clan
>
Metallo protease M10A subfamily
|
||||
Function |
Plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC and ACAN. Cleaves triple helical collagens, including type I, type II and type III collagen, but has the highest activity with soluble type II collagen. Can also degrade collagen type IV, type XIV and type X. May also function by activating or degrading key regulatory proteins, such as TGFB1 and CCN2. Plays a role in wound healing, tissue remodeling, cartilage degradation, bone development, bone mineralization and ossification. Required for normal embryonic bone development and ossification. Plays a role in the healing of bone fractures via endochondral ossification. Plays a role in wound healing, probably by a mechanism that involves proteolytic activation of TGFB1 and degradation of CCN2. Plays a role in keratinocyte migration during wound healing. May play a role in cell migration and in tumor cell invasion.
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
Ensembl ID | |||||
HGNC ID | |||||
Subcellular Location |
Secreted
Extracellular space
Extracellular matrix
Secreted
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000011 , CHO
Cell Line ID: CL000265 , NS0
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Matrix metalloproteinase-13 (MMP-13) )
Target Type | Clinical trial Target | ||||
---|---|---|---|---|---|
Disease | 5 Target-related Diseases | 5 | |||
1 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | ||||
2 | Rheumatoid arthritis [ICD-11: FA20] | ||||
3 | Pain [ICD-11: MG30-MG3Z] | ||||
4 | Corneal ulcer [ICD-11: 9A76] | ||||
5 | Hepatitis C virus infection [ICD-11: 1E51.1] | ||||
Clinical Trial Drug(s) | 3 Clinical Trial Drugs | 3 | |||
1 | Curcumin | Phase 3 | |||
2 | Apratastat | Phase 2 | |||
3 | PMID17935984C1 | Clinical trial | |||
Discontinued Drug(s) | 2 Discontinued Drugs | 2 | |||
1 | GM6001 | Discontinued in Phase 2 | |||
2 | RS-130830 | Discontinued in Phase 2 |