General Information of the Protein
| Protein ID |
PT01023
|
||||
|---|---|---|---|---|---|
| Protein Name |
Cyclin-dependent kinase 4
|
||||
| Secondarily Protein Name |
Cell division protein kinase 4
PSK-J3
|
||||
| Gene Name |
CDK4
|
||||
| Sequence |
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Show/Hide
|
||||
| Organism |
Homo sapiens, Human
|
||||
| Protein Classification |
Enzyme
>
Kinase
>
Protein Kinase
>
CMGC protein kinase group
|
||||
| Function |
Ser/Thr-kinase component of cyclin D-CDK4 (DC) complexes that phosphorylate and inhibit members of the retinoblastoma (RB) protein family including RB1 and regulate the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complexes and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also phosphorylates SMAD3 in a cell-cycle-dependent manner and represses its transcriptional activity. Component of the ternary complex, cyclin D/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex.
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Subcellular Location |
Cytoplasm
Nucleus
Nucleus membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000182 , JeKo-1
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Cyclin-dependent kinase 4 (CDK4) )
| Target Type | Successful Target | ||||
|---|---|---|---|---|---|
| Disease | 7 Target-related Diseases | 7 | |||
| 1 | Psoriasis vulgaris [ICD-11: EA90] | ||||
| 2 | Breast cancer [ICD-11: 2C60-2C65] | ||||
| 3 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | ||||
| 4 | Mantle cell lymphoma [ICD-11: 2A85.5] | ||||
| 5 | Small-cell lung cancer [ICD-11: 2C25.Y] | ||||
| 6 | Advanced solid tumour [ICD-11: 2A00-2F9Z] | ||||
| 7 | Retinoblastoma [ICD-11: 2D02.2] | ||||
| Approved Drug(s) | 4 Approved Drugs | 4 | |||
| 1 | Apremilast | Approved | |||
| 2 | LY2835219 | Approved | |||
| 3 | Palbociclib | Approved | |||
| 4 | Trilaciclib | Approved | |||
| Clinical Trial Drug(s) | 9 Clinical Trial Drugs | 9 | |||
| 1 | LEE011 | Phase 3 | |||
| 2 | G1T38 | Phase 2 | |||
| 3 | P-276 | Phase 2 | |||
| 4 | P276-00 | Phase 2 | |||
| 5 | Ro 31-7453 | Phase 2 | |||
| 6 | AG-024322 | Phase 1 | |||
| 7 | FN-1501 | Phase 1 | |||
| 8 | P1446A-05 | Phase 1 | |||
| 9 | PHA-793887 | Phase 1 | |||
| Discontinued Drug(s) | 3 Discontinued Drugs | 3 | |||
| 1 | BAY 10-00394 | Discontinued in Phase 2 | |||
| 2 | R547 | Discontinued in Phase 1 | |||
| 3 | PD-0183812 | Terminated | |||