General Information of the Protein
Protein ID |
PT00848
|
||||
---|---|---|---|---|---|
Protein Name |
Interstitial collagenase
|
||||
Secondarily Protein Name |
Fibroblast collagenase
Matrix metalloproteinase-1
|
||||
Gene Name |
MMP1
|
||||
Secondarily Gene Name |
CLG
|
||||
Sequence |
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Show/Hide
|
||||
Organism |
Homo sapiens, Human
|
||||
Protein Classification |
Enzyme
>
Protease
>
Metallo protease
>
Metallo protease MAM clan
>
Metallo protease M10A subfamily
|
||||
Function |
Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X (PubMed:2557822, PubMed:2153297, PubMed:1645757). In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity (PubMed:16807369).
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
HGNC ID | |||||
Subcellular Location |
Secreted
Extracellular space
Extracellular matrix
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000068 , A-549
Cell Line ID: CL000011 , CHO
Cell Line ID: CL000006 , HEK293
Cell Line ID: CL000156 , HT-1080
Cell Line ID: CL000265 , NS0
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Matrix metalloproteinase-1 (MMP-1) )
Target Type | Successful Target | ||||
---|---|---|---|---|---|
Disease | 8 Target-related Diseases | 8 | |||
1 | Lung cancer [ICD-11: 2C25.0] | ||||
2 | Rheumatoid arthritis [ICD-11: FA20] | ||||
3 | Pancreatic cancer [ICD-11: 2C10] | ||||
4 | Corneal ulcer [ICD-11: 9A76] | ||||
5 | Hepatitis C virus infection [ICD-11: 1E51.1] | ||||
6 | Multiple sclerosis [ICD-11: 8A40] | ||||
7 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | ||||
8 | Arthritis [ICD-11: FA20] | ||||
Approved Drug(s) | 1 Approved Drug | 1 | |||
1 | Prinomastat | Approved | |||
Clinical Trial Drug(s) | 3 Clinical Trial Drugs | 3 | |||
1 | CIPEMASTAT | Phase 3 | |||
2 | Apratastat | Phase 2 | |||
3 | Marimastat | Phase 3 | |||
Discontinued Drug(s) | 6 Discontinued Drugs | 6 | |||
1 | GM6001 | Discontinued in Phase 2 | |||
2 | RS-130830 | Discontinued in Phase 2 | |||
3 | BB-1101 | Terminated | |||
4 | BB-3644 | Terminated | |||
5 | Ro-31-4724 | Terminated | |||
6 | RO-319790 | Terminated |