General Information of the Protein
| Protein ID |
PT00842
|
||||
|---|---|---|---|---|---|
| Protein Name |
72 kDa type IV collagenase
|
||||
| Secondarily Protein Name |
72 kDa gelatinase
Gelatinase A
Matrix metalloproteinase-2
TBE-1
|
||||
| Gene Name |
MMP2
|
||||
| Secondarily Gene Name |
CLG4A
|
||||
| Sequence |
MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Show/Hide
|
||||
| Organism |
Homo sapiens, Human
|
||||
| Protein Classification |
Enzyme
>
Protease
>
Metallo protease
>
Metallo protease MAM clan
>
Metallo protease M10A subfamily
|
||||
| Function |
Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly-|-Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascular tissues in association with MMP14.
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Subcellular Location |
Secreted
Extracellular space
Extracellular matrix
Membrane
Nucleus
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000011 , CHO
Cell Line ID: CL000265 , NS0
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Matrix metalloproteinase-2 (MMP-2) )
| Target Type | Successful Target | ||||
|---|---|---|---|---|---|
| Disease | 8 Target-related Diseases | 8 | |||
| 1 | Lung cancer [ICD-11: 2C25.0] | ||||
| 2 | Hepatic fibrosis [ICD-11: DB93.0] | ||||
| 3 | Pancreatic cancer [ICD-11: 2C10] | ||||
| 4 | Osteoarthritis [ICD-11: FA00-FA05] | ||||
| 5 | Corneal ulcer [ICD-11: 9A76] | ||||
| 6 | Hepatitis C virus infection [ICD-11: 1E51.1] | ||||
| 7 | Multiple sclerosis [ICD-11: 8A40] | ||||
| 8 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | ||||
| Approved Drug(s) | 1 Approved Drug | 1 | |||
| 1 | Prinomastat | Approved | |||
| Clinical Trial Drug(s) | 2 Clinical Trial Drugs | 2 | |||
| 1 | Epigallocatechin gallate | Phase 3 | |||
| 2 | Marimastat | Phase 3 | |||
| Discontinued Drug(s) | 5 Discontinued Drugs | 5 | |||
| 1 | Tanomastat | Discontinued in Phase 3 | |||
| 2 | GM6001 | Discontinued in Phase 2 | |||
| 3 | RS-130830 | Discontinued in Phase 2 | |||
| 4 | BB-1101 | Terminated | |||
| 5 | BB-3644 | Terminated | |||
Target 2 ( MMP2 messenger RNA (MMP2 mRNA) )
| Target Type | Literature-reported Target | ||||
|---|---|---|---|---|---|