General Information of the Protein
Protein ID |
PT01800
|
||||
---|---|---|---|---|---|
Protein Name |
Cysteinyl leukotriene receptor 1
|
||||
Secondarily Protein Name |
Cysteinyl leukotriene D4 receptor
G-protein coupled receptor HG55
HMTMF81
|
||||
Gene Name |
CYSLTR1
|
||||
Secondarily Gene Name |
CYSLT1
|
||||
Sequence |
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
Show/Hide
|
||||
Organism |
Homo sapiens, Human
|
||||
Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Small molecule receptor (family A GPCR)
>
Lipid-like ligand receptor (family A GPCR)
>
Leukotriene receptor
|
||||
Function |
Receptor for cysteinyl leukotrienes mediating bronchoconstriction of individuals with and without asthma. Stimulation by LTD4 results in the contraction and proliferation of smooth muscle, edema, eosinophil migration and damage to the mucus layer in the lung. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The rank order of affinities for the leukotrienes is LTD4 >> LTE4 = LTC4 >> LTB4.
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
Ensembl ID | |||||
HGNC ID | |||||
Subcellular Location |
Cell membrane
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000026 , CHO-K1
Cell Line ID: CL000011 , CHO
Cell Line ID: CL000053 , COS-7
Cell Line ID: CL000006 , HEK293
Cell Line ID: CL000125 , MCB3901
Cell Line ID: CL000100 , U-937
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Leukotriene CysLT1 receptor (CYSLTR1) )
Target Type | Successful Target | ||||
---|---|---|---|---|---|
Disease | 1 Target-related Disease | 1 | |||
1 | Asthma [ICD-11: CA23] | ||||
Approved Drug(s) | 4 Approved Drugs | 4 | |||
1 | Cinalukast | Approved | |||
2 | Montelukast | Approved | |||
3 | Pranlukast | Approved | |||
4 | Zafirlukast | Approved | |||
Clinical Trial Drug(s) | 1 Clinical Trial Drug | 1 | |||
1 | Masilukast | Phase 2 | |||
Discontinued Drug(s) | 6 Discontinued Drugs | 6 | |||
1 | Ablukast | Discontinued in Phase 3 | |||
2 | RG-7152 | Discontinued in Phase 1 | |||
3 | FPL-55712 | Terminated | |||
4 | ICI-198615 | Terminated | |||
5 | LM-1376 | Terminated | |||
6 | Tomelukast | Terminated |