General Information of the Protein
Protein ID |
PT01526
|
||||
---|---|---|---|---|---|
Protein Name |
Delta-type opioid receptor
|
||||
Secondarily Protein Name |
Opioid receptor A
|
||||
Gene Name |
OPRD1
|
||||
Secondarily Gene Name |
Ror-a
|
||||
Sequence |
MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTACTPSDGPGGGAAA
Show/Hide
|
||||
Organism |
Rattus norvegicus, Rat
|
||||
Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Peptide receptor (family A GPCR)
>
Short peptide receptor (family A GPCR)
>
Opioid receptor
|
||||
Function |
G-protein coupled receptor that functions as a receptor for endogenous enkephalins and for a subset of other opioids. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain and in opiate-mediated analgesia. Plays a role in developing analgesic tolerance to morphine.
Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
Subcellular Location |
Cell membrane
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000047 , 108CC15
Cell Line ID: CL000051 , BHK-21
Cell Line ID: CL000049 , C6
Cell Line ID: CL000011 , CHO
Cell Line ID: CL000026 , CHO-K1
Cell Line ID: CL001020 , EE-HEK293
Cell Line ID: CL000033 , GH3
Cell Line ID: CL000006 , HEK293
Biochemical Assays
Similar Protein(s) and Bioactivity Statistics
50% Identity
Protein ID | Protein Name | Protein Organism | |
PT00642 | Opioid receptor, delta 1b | Danio rerio, Zebrafish, Brachydanio rerio |
---|