General Information of the Protein
Protein ID |
PT01505
|
||||
---|---|---|---|---|---|
Protein Name |
Somatostatin receptor type 2
|
||||
Secondarily Protein Name |
SRIF-1
|
||||
Gene Name |
SSTR2
|
||||
Sequence |
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
Show/Hide
|
||||
Organism |
Homo sapiens, Human
|
||||
Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Peptide receptor (family A GPCR)
>
Short peptide receptor (family A GPCR)
>
Somatostatin receptor
|
||||
Function |
Receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and PLC via pertussis toxin insensitive as well as sensitive G proteins. Inhibits calcium entry by suppressing voltage-dependent calcium channels. Acts as the functionally dominant somatostatin receptor in pancreatic alpha- and beta-cells where it mediates the inhibitory effect of somatostatin-14 on hormone secretion. Inhibits cell growth through enhancement of MAPK1 and MAPK2 phosphorylation and subsequent up-regulation of CDKN1B. Stimulates neuronal migration and axon outgrowth and may participate in neuron development and maturation during brain development. Mediates negative regulation of insulin receptor signaling through PTPN6. Inactivates SSTR3 receptor function following heterodimerization.
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
Ensembl ID | |||||
HGNC ID | |||||
Subcellular Location |
Cell membrane
Cytoplasm
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000383 , AR42J
Cell Line ID: CL000443 , CC531
Cell Line ID: CL000011 , CHO
Cell Line ID: CL000389 , CHO-DXB11
Cell Line ID: CL000026 , CHO-K1
Cell Line ID: CL000351 , Dede
Cell Line ID: CL000029 , GH4C1
Cell Line ID: CL000006 , HEK293
Cell Line ID: CL000050 , HEK293-A
Cell Line ID: CL000020 , Neuro-2a
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Somatostatin receptor type 2 (SSTR2) )
Target Type | Successful Target | ||||
---|---|---|---|---|---|
Disease | 2 Target-related Diseases | 2 | |||
1 | Acromegaly [ICD-11: 5A60.0] | ||||
2 | Cushing disease [ICD-11: 5A70] | ||||
Approved Drug(s) | 2 Approved Drugs | 2 | |||
1 | Octreotide | Approved | |||
2 | Pasireotide | Approved | |||
Clinical Trial Drug(s) | 1 Clinical Trial Drug | 1 | |||
1 | Paltusotine | Phase 3 |