General Information of the Protein
Protein ID |
PT06676
|
||||
---|---|---|---|---|---|
Protein Name |
Fusion glycoprotein F0
|
||||
Secondarily Protein Name |
Intervening segment
Pep27
Peptide 27
|
||||
Gene Name |
F
|
||||
Sequence |
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Show/Hide
|
||||
Organism |
Human respiratory syncytial virus A (strain A2)
|
||||
Protein Classification |
Surface antigen
|
||||
Function |
Inactive precursor that is cleaved at two sites by a furin-like protease to give rise to the mature F1 and F2 fusion glycoproteins.
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
Subcellular Location |
Host Golgi apparatus membrane
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000668 , HEp-2
Cell Line ID: CL000025 , HEK-293T
Cell Line ID: CL000063 , Hep-G2
Clinical Information about the Protein
Target 1 ( Respiratory syncytial virus protein F (RSV F) )
Target Type | Successful Target | ||||
---|---|---|---|---|---|
Disease | 2 Target-related Diseases | 2 | |||
1 | Osteoporosis [ICD-11: FB83.0] | ||||
2 | Respiratory syncytial virus infection [ICD-11: 1C80] | ||||
Approved Drug(s) | 1 Approved Drug | 1 | |||
1 | Lasofoxifene | Approved | |||
Clinical Trial Drug(s) | 3 Clinical Trial Drugs | 3 | |||
1 | GS-5806 | Phase 2 | |||
2 | JNJ-53718678 | Phase 2 | |||
3 | RV521 | Phase 2 |
Similar Protein(s) and Bioactivity Statistics
50% Identity
Protein ID | Protein Name | Protein Organism | |
PT00459 | Fusion glycoprotein F0 | Human respiratory syncytial virus |
---|