General Information of the Protein
| Protein ID |
PT06676
|
||||
|---|---|---|---|---|---|
| Protein Name |
Fusion glycoprotein F0
|
||||
| Secondarily Protein Name |
Intervening segment
Pep27
Peptide 27
|
||||
| Gene Name |
F
|
||||
| Sequence |
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Show/Hide
|
||||
| Organism |
Human respiratory syncytial virus A (strain A2)
|
||||
| Protein Classification |
Surface antigen
|
||||
| Function |
Inactive precursor that is cleaved at two sites by a furin-like protease to give rise to the mature F1 and F2 fusion glycoproteins.
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Subcellular Location |
Host Golgi apparatus membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000668 , HEp-2
Cell Line ID: CL000025 , HEK-293T
Cell Line ID: CL000063 , Hep-G2
Clinical Information about the Protein
Target 1 ( Respiratory syncytial virus protein F (RSV F) )
| Target Type | Successful Target | ||||
|---|---|---|---|---|---|
| Disease | 2 Target-related Diseases | 2 | |||
| 1 | Osteoporosis [ICD-11: FB83.0] | ||||
| 2 | Respiratory syncytial virus infection [ICD-11: 1C80] | ||||
| Approved Drug(s) | 1 Approved Drug | 1 | |||
| 1 | Lasofoxifene | Approved | |||
| Clinical Trial Drug(s) | 3 Clinical Trial Drugs | 3 | |||
| 1 | GS-5806 | Phase 2 | |||
| 2 | JNJ-53718678 | Phase 2 | |||
| 3 | RV521 | Phase 2 | |||
Similar Protein(s) and Bioactivity Statistics
50% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT00459 | Fusion glycoprotein F0 | Human respiratory syncytial virus | |
|---|---|---|---|