General Information of the Protein
| Protein ID |
PT06585
|
||||
|---|---|---|---|---|---|
| Protein Name |
Very long chain fatty acid elongase 6
|
||||
| Secondarily Protein Name |
3-keto acyl-CoA synthase Elovl6
ELOVL fatty acid elongase 6
Elongation of very long chain fatty acids protein 6
Fatty acyl-CoA elongase
Long chain fatty acid elongase
Myelin-associated SUR4 protein
Very long chain 3-ketoacyl-CoA synthase 6
Very long chain 3-oxoacyl-CoA synthase 6
|
||||
| Gene Name |
ELOVL6
|
||||
| Secondarily Gene Name |
Face
Lce
Masr
|
||||
| Sequence |
MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATKAE
Show/Hide
|
||||
| Organism |
Mus musculus, Mouse
|
||||
| Protein Classification |
Enzyme
>
Transferase
|
||||
| Function |
Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that elongates fatty acids with 12, 14 and 16 carbons with higher activity toward C16:0 acyl-CoAs. Catalyzes the synthesis of unsaturated C16 long chain fatty acids and, to a lesser extent, C18:0 and those with low desaturation degree. May participate in the production of saturated and monounsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Ensembl ID | |||||
| Subcellular Location |
Endoplasmic reticulum membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000053 , COS-7
Cell Line ID: CL000961 , H2.35
Similar Protein(s) and Bioactivity Statistics
50% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT06084 | Very long chain fatty acid elongase 6 | Homo sapiens, Human | |
|---|---|---|---|