General Information of the Protein
| Protein ID |
PT06252
|
||||
|---|---|---|---|---|---|
| Protein Name |
Sterol O-acyltransferase 1
|
||||
| Secondarily Protein Name |
Acyl-coenzyme A:cholesterol acyltransferase 1
Cholesterol acyltransferase 1
|
||||
| Gene Name |
SOAT1
|
||||
| Secondarily Gene Name |
ACAT1
|
||||
| Sequence |
MVGEEKMSLRNRLSKSRENPEEDEDQRKPAKESLEAPSNGRIDIKQLIAKKIKLTAEAEELKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQRWATGYSKSSHPLINSLFHGFLFMVFQIGILGFGPTYVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWGYVAMQFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYAYKDFLWFFSKRFKSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFMFFGMAFNFIVNDSRKKPIWNVMMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVRPRSWTCRYVF
Show/Hide
|
||||
| Organism |
Chlorocebus aethiops, Green monkey, Cercopithecus aethiops
|
||||
| Protein Classification |
Enzyme
>
Transferase
|
||||
| Function |
Catalyzes the formation of fatty acid-cholesterol esters, which are less soluble in membranes than cholesterol. Plays a role in lipoprotein assembly and dietary cholesterol absorption. Utilizes oleoyl-CoA ((9Z)-octadecenoyl-CoA) preferentially as susbstrate: shows a higher activity towards an acyl-CoA substrate with a double bond at the delta-9 position (9Z) than towards saturated acyl-CoA or an unsaturated acyl-CoA with a double bond at the delta-7 (7Z) or delta-11 (11Z) positions.
Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| Subcellular Location |
Endoplasmic reticulum membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000582 , AC29
Cell Line ID: CL000011 , CHO
Similar Protein(s) and Bioactivity Statistics
90% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT01327 | Sterol O-acyltransferase 1 | Homo sapiens, Human | |
|---|---|---|---|
50% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT03513 | Sterol O-acyltransferase 1 | Mus musculus, Mouse | |
|---|---|---|---|