General Information of the Protein
Protein ID |
PT03513
|
||||
---|---|---|---|---|---|
Protein Name |
Sterol O-acyltransferase 1
|
||||
Secondarily Protein Name |
Acyl-coenzyme A:cholesterol acyltransferase 1
Cholesterol acyltransferase 1
|
||||
Gene Name |
SOAT1
|
||||
Secondarily Gene Name |
Acact
|
||||
Sequence |
MSLRNRLSKSGENPEQDEAQKNFMDTYRNGHITMKQLIAKKRLLAAEAEELKPLFMKEVGCHFDDFVTNLIEKSASLDNGGCALTTFSILEEMKKNHRAKDLRAPPEQGKIFISRQSLLDELFEVDHIRTIYHMFIALLILFVLSTIVVDYIDEGRLVLEFNLLAYAFGKFPTVIWTWWAMFLSTLSIPYFLFQRWAHGYSKSSHPLIYSLVHGLLFLVFQLGVLGFVPTYVVLAYTLPPASRFILILEQIRLIMKAHSFVRENIPRVLNAAKEKSSKDPLPTVNQYLYFLFAPTLIYRDNYPRTPTVRWGYVAMQFLQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLILFLSFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYVYKDLLWFFSKRFKSAAMLAVFALSAVVHEYALAICLSYFYPVLFVLFMFFGMAFNFIVNDSRKRPIWNIMVWASLFLGYGLILCFYSQEWYARQHCPLKNPTFLDYVRPRTWTCRYVF
Show/Hide
|
||||
Organism |
Mus musculus, Mouse
|
||||
Protein Classification |
Enzyme
>
Transferase
|
||||
Function |
Catalyzes the formation of fatty acid-cholesterol esters, which are less soluble in membranes than cholesterol. Plays a role in lipoprotein assembly and dietary cholesterol absorption. Utilizes oleoyl-CoA ((9Z)-octadecenoyl-CoA) preferentially as susbstrate: shows a higher activity towards an acyl-CoA substrate with a double bond at the delta-9 position (9Z) than towards saturated acyl-CoA or an unsaturated acyl-CoA with a double bond at the delta-7 (7Z) or delta-11 (11Z) positions.
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
Ensembl ID | |||||
Subcellular Location |
Endoplasmic reticulum membrane
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Similar Protein(s) and Bioactivity Statistics
50% Identity
Protein ID | Protein Name | Protein Organism | |
PT01327 | Sterol O-acyltransferase 1 | Homo sapiens, Human | |
---|---|---|---|
PT06252 | Sterol O-acyltransferase 1 | Chlorocebus aethiops, Green monkey, Cercopithecus aethiops |