Protein Information

General Information of the Protein

Protein ID	PT05025
Protein Name	Adenosine receptor A3
Secondarily Protein Name	A3AR
Gene Name	ADORA3
Secondarily Gene Name	Gpcr2
Sequence	MEADNTTETDWLNITYITMEAAIGLCAVVGNMLVIWVVKLNPTLRTTTVYFIVSLALADIAVGVLVIPLAIAVSLQVKMHFYACLFMSCVLLIFTHASIMSLLAIAVHRYLRVKLTVRYRTVTTQRRIWLFLGLCWLVSFLVGLTPMFGWNRKATLASSQNSSTLLCHFRSVVSLDYMVFFSFITWILVPLVVMCIIYLDIFYIIRNKLSQNLTGFRETRAFYGREFKTAKSLFLVLFLFALCWLPLSIINFVSYFDVKIPDVAMCLGILLSHANSMMNPIVYACKIKKFKETYFLILRAVRLCQTSDSLDSNMEQTTE Show/Hide
Organism	Mus musculus, Mouse
Protein Classification	Membrane receptor > Family A G protein-coupled receptor > Small molecule receptor (family A GPCR) > Nucleotide-like receptor (family A GPCR) > Adenosine receptor
Function	Receptor for adenosine. The activity of this receptor is mediated by G proteins which inhibits adenylyl cyclase. Show/Hide
Uniprot ID	Primary ID: Q61618 Secondarily ID: Q9R202 Show/Hide
Subcellular Location	Cell membrane

Map of Molecular Bioactivity Related to the Protein

Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity

Table of Molecular Bioactivities Related to the Protein

Cell Line ID: CL000011 , CHO

Cell Line Info

Compound ID	Compound Name	Compound Formula
CP0415983 Compound Info	3-ethyl-6-(4-hydroxypiperidine-1-carbonyl)-5-methyl-1-(3,3,3-trifluoropropyl)thieno[2,3-d]pyrimidine-2,4-dione Show/Hide	C18H22F3N3O4S	1
1	IC50 > 6700 nM Bioactivity Info	TI LI LO TS
CP0448164 Compound Info	(1S,2R,3S,4R,5S)-4-[6-[(3-chlorophenyl)methylamino]-2-[4-(5-chlorothiophen-2-yl)triazol-1-yl]purin-9-yl]-2,3-dihydroxy-N-methylbicyclo[3.1.0]hexane-1-carboxamide Show/Hide	C26H23Cl2N9O3S	1
1	Ki = 6.53 nM Bioactivity Info	TI LI LO TS
CP0406220 Compound Info	(1S,2R,3S,4R,5S)-4-[2-[4-(5-chlorothiophen-2-yl)triazol-1-yl]-6-(ethylamino)purin-9-yl]-2,3-dihydroxy-N-methylbicyclo[3.1.0]hexane-1-carboxamide Show/Hide	C21H22ClN9O3S	1
1	Ki = 9.64 nM Bioactivity Info	TI LI LO TS
CP0039348 Compound Info	(2S,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-N-ethyl-3,4-dihydroxyoxolane-2-carboxamide Show/Hide	C12H16N6O4	1
1	Ki = 14.1 nM Bioactivity Info	TI LI LO TS
CP0406164 Compound Info	(1S,2R,3S,4R,5S)-4-[2-[4-(5-chlorothiophen-2-yl)triazol-1-yl]-6-(cyclobutylamino)purin-9-yl]-2,3-dihydroxy-N-methylbicyclo[3.1.0]hexane-1-carboxamide Show/Hide	C23H24ClN9O3S	1
1	Ki = 14.2 nM Bioactivity Info	TI LI LO TS
CP0108871 Compound Info	(1S,2R,3S,4R,5S)-4-[5-[2-(5-chlorothiophen-2-yl)ethynyl]-7-(ethylamino)imidazo[4,5-b]pyridin-3-yl]-2,3-dihydroxy-N-methylbicyclo[3.1.0]hexane-1-carboxamide Show/Hide	C22H22ClN5O3S	1
1	Ki = 16.2 nM Bioactivity Info	TI LI LO TS
CP0077413 Compound Info	(2R,3R,4S,5R)-2-(2-Chloro-6-cyclopentylamino-purin-9-yl)-5-hydroxymethyl-tetrahydro-furan-3,4-diol Show/Hide	C15H20ClN5O4	1
1	Ki = 17 nM Bioactivity Info	TI LI LO TS
CP0169089 Compound Info	(1S,2R,3S,4R,5S)-4-[6-[[(1R,2S,4S)-2-bicyclo[2.2.1]heptanyl]amino]-2-chloropurin-9-yl]-N-cyclopropyl-2,3-dihydroxybicyclo[3.1.0]hexane-1-carboxamide Show/Hide	C22H27ClN6O3	1
1	Ki = 29.5 nM Bioactivity Info	TI LI LO TS
CP0448165 Compound Info	(1S,2R,3S,4R,5S)-2,3-dihydroxy-N-methyl-4-[6-(methylamino)-2-(4-pyrimidin-2-yltriazol-1-yl)purin-9-yl]bicyclo[3.1.0]hexane-1-carboxamide Show/Hide	C20H21N11O3	1
1	Ki = 334 nM Bioactivity Info	TI LI LO TS
CP0266843 Compound Info	(1R,2R,3S,4R,5S)-4-[2-chloro-6-[di(cyclobutyl)methylamino]purin-9-yl]bicyclo[3.1.0]hexane-2,3-diol Show/Hide	C20H26ClN5O2	1
1	Ki = 385 nM Bioactivity Info	TI LI LO TS
CP0362924 Compound Info	(2R,3R,4S,5R)-2-[6-[[(1R,2S,4S)-2-bicyclo[2.2.1]heptanyl]amino]purin-9-yl]-5-(hydroxymethyl)oxolane-3,4-diol Show/Hide	C17H23N5O4	1
1	Ki = 424 nM Bioactivity Info	TI LI LO TS
CP0440591 Compound Info	(1S,2R,3S,4R,5S)-4-[6-[[(1R,2S,4S)-2-bicyclo[2.2.1]heptanyl]amino]-2-chloropurin-9-yl]-2,3-dihydroxy-N-(2-hydroxyethyl)bicyclo[3.1.0]hexane-1-carboxamide Show/Hide	C21H27ClN6O4	1
1	Ki = 447 nM Bioactivity Info	TI LI LO TS
CP0266847 Compound Info	(1S,2R,3S,4R,5S)-4-[6-[[(1R,2S,4S)-2-bicyclo[2.2.1]heptanyl]amino]-2-chloropurin-9-yl]-1-(chloromethyl)bicyclo[3.1.0]hexane-2,3-diol Show/Hide	C19H23Cl2N5O2	1
1	Ki = 503 nM Bioactivity Info	TI LI LO TS
CP0049200 Compound Info	(2R,3R,4S,5R)-2-[6-(cyclopentylamino)-9H-purin-9-yl]-5-(hydroxymethyl)oxolane-3,4-diol Show/Hide	C15H21N5O4	1
1	Ki = 534 nM Bioactivity Info	TI LI LO TS
CP0169097 Compound Info	(1R,2R,3S,4R,5S)-4-[6-[[(1R,2S,4S)-2-bicyclo[2.2.1]heptanyl]amino]-2-chloropurin-9-yl]-1-(hydroxymethyl)bicyclo[3.1.0]hexane-2,3-diol Show/Hide	C19H24ClN5O3	1
1	Ki = 574 nM Bioactivity Info	TI LI LO TS
CP0139868 Compound Info	(1R,2R,3S,4R,5S)-4-[2-chloro-6-[di(cyclobutyl)methylamino]purin-9-yl]-1-(hydroxymethyl)bicyclo[3.1.0]hexane-2,3-diol Show/Hide	C21H28ClN5O3	1
1	Ki = 612 nM Bioactivity Info	TI LI LO TS
CP0139864 Compound Info	(2R,3R,4S,5R)-2-[2-chloro-6-[di(cyclobutyl)methylamino]purin-9-yl]-5-(hydroxymethyl)oxolane-3,4-diol Show/Hide	C19H26ClN5O4	1
1	Ki = 653 nM Bioactivity Info	TI LI LO TS
CP0354472 Compound Info	(2R,3R,4S,5S)-2-[6-[di(cyclobutyl)methylamino]purin-9-yl]-5-(ethylsulfanylmethyl)oxolane-3,4-diol Show/Hide	C21H31N5O3S	1
1	Ki = 718 nM Bioactivity Info	TI LI LO TS
CP0204638 Compound Info	(2R,3R,4S,5R)-2-[6-[di(cyclobutyl)methylamino]purin-9-yl]-5-(hydroxymethyl)oxolane-3,4-diol Show/Hide	C19H27N5O4	1
1	Ki = 897 nM Bioactivity Info	TI LI LO TS
CP0169091 Compound Info	(1R,2R,3S,4R,5S)-4-[6-[di(cyclobutyl)methylamino]purin-9-yl]-1-(hydroxymethyl)bicyclo[3.1.0]hexane-2,3-diol Show/Hide	C21H29N5O3	1
1	Ki = 918 nM Bioactivity Info	TI LI LO TS
CP0139869 Compound Info	(1S,2R,3S,4R,5S)-1-(chloromethyl)-4-[6-[di(cyclobutyl)methylamino]purin-9-yl]bicyclo[3.1.0]hexane-2,3-diol Show/Hide	C21H28ClN5O2	1
1	Ki = 934 nM Bioactivity Info	TI LI LO TS
CP0169100 Compound Info	(1R,2R,3S,4R,5S)-4-[2-chloro-6-(dicyclopropylmethylamino)purin-9-yl]bicyclo[3.1.0]hexane-2,3-diol Show/Hide	C18H22ClN5O2	1
1	Ki = 1060 nM Bioactivity Info	TI LI LO TS
CP0139866 Compound Info	(2R,3R,4S,5S)-2-[6-[[(1R,2S,4S)-2-bicyclo[2.2.1]heptanyl]amino]purin-9-yl]-5-(chloromethyl)oxolane-3,4-diol Show/Hide	C17H22ClN5O3	1
1	Ki = 1560 nM Bioactivity Info	TI LI LO TS
CP0169092 Compound Info	(1S,2R,3S,4R,5S)-4-[2-chloro-6-[di(cyclobutyl)methylamino]purin-9-yl]-1-(chloromethyl)bicyclo[3.1.0]hexane-2,3-diol Show/Hide	C21H27Cl2N5O2	1
1	Ki = 1560 nM Bioactivity Info	TI LI LO TS
CP0169090 Compound Info	(2S,3S,4R,5R)-2-(chloromethyl)-5-[6-[di(cyclobutyl)methylamino]purin-9-yl]oxolane-3,4-diol Show/Hide	C19H26ClN5O3	1
1	Ki = 2110 nM Bioactivity Info	TI LI LO TS
CP0534305 Compound Info	(2R,3R,4S,5S)-2-[6-[[(1R,4S)-2-bicyclo[2.2.1]heptanyl]amino]purin-9-yl]-5-(chloromethyl)oxolane-3,4-diol Show/Hide	C17H22ClN5O3	1
1	Ki = 2410 nM Bioactivity Info	TI LI LO TS
CP0204629 Compound Info	(1S,2R,3S,4R,5S)-4-[2-chloro-6-[di(cyclobutyl)methylamino]purin-9-yl]-1-[(2-fluorophenyl)sulfanylmethyl]bicyclo[3.1.0]hexane-2,3-diol Show/Hide	C27H31ClFN5O2S	1
1	Ki = 7440 nM Bioactivity Info	TI LI LO TS
CP0065233 Compound Info	4-(2,6-Dioxo-1-propyl-2,3,6,7-tetrahydro-1H-purin-8-yl)-benzenesulfonic acid Show/Hide	C14H14N4O5S	1
1	Ki > 10000 nM Bioactivity Info	TI LI LO TS
CP0069838 Compound Info	(4-Cyano-phenyl)-carbamic acid 4-(2,6-dioxo-1,3-dipropyl-2,3,6,7-tetrahydro-1H-purin-8-yl)-phenyl ester Show/Hide	C26H26N6O4	1
1	Ki > 10000 nM Bioactivity Info	TI LI LO TS
CP0420800 Compound Info	8-[4-[4-(4-chlorophenyl)piperazin-1-yl]sulfonylphenyl]-3-methyl-1-propyl-7H-purine-2,6-dione Show/Hide	C25H27ClN6O4S	1
1	Ki > 1000 nM Bioactivity Info	TI LI LO TS
CP0420803 Compound Info	8-[4-[4-(4-bromophenyl)piperazin-1-yl]sulfonylphenyl]-1-propyl-3,7-dihydropurine-2,6-dione Show/Hide	C24H25BrN6O4S	1
1	Ki > 1000 nM Bioactivity Info	TI LI LO TS
CP0420820 Compound Info	8-[4-[4-(3-fluorophenyl)piperazin-1-yl]sulfonylphenyl]-1-propyl-3,7-dihydropurine-2,6-dione Show/Hide	C24H25FN6O4S	1
1	Ki > 1000 nM Bioactivity Info	TI LI LO TS
CP0424466 Compound Info	8-[4-[4-[(3-bromophenyl)methyl]piperazin-1-yl]sulfonylphenyl]-1-propyl-3,7-dihydropurine-2,6-dione Show/Hide	C25H27BrN6O4S	1
1	Ki > 1000 nM Bioactivity Info	TI LI LO TS

Cell Line ID: CL000025 , HEK-293T

Cell Line Info

Cell Line ID: CL000006 , HEK293

Cell Line Info

Similar Protein(s) and Bioactivity Statistics

90% Identity

Protein ID	Protein Name	Protein Organism
PT01827	Adenosine receptor A3	Rattus norvegicus, Rat	Protein Info

50% Identity

Protein ID	Protein Name	Protein Organism
PT01279	Adenosine receptor A3	Homo sapiens, Human	Protein Info
PT06240	Adenosine receptor A3	Canis lupus familiaris, Dog, Canis familiaris	Protein Info

Cite

About MolBiC

Correspondence

Prof. Feng ZHU

Prof. Leo, Lianyi Han