General Information of the Protein
Protein ID |
PT01929
|
||||
---|---|---|---|---|---|
Protein Name |
Synaptic vesicular amine transporter
|
||||
Secondarily Protein Name |
Monoamine transporter
Solute carrier family 18 member 2
Vesicular amine transporter 2
|
||||
Gene Name |
SLC18A2
|
||||
Secondarily Gene Name |
SVMT
VMAT2
|
||||
Sequence |
MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKMAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
Show/Hide
|
||||
Organism |
Homo sapiens, Human
|
||||
Protein Classification |
Transporter
>
Electrochemical transporter
>
SLC superfamily of solute carriers
>
SLC18 family of vesicular amine transporters
|
||||
Function |
Electrogenic antiporter that exchanges one cationic monoamine with two intravesicular protons across the membrane of secretory and synaptic vesicles. Uses the electrochemical proton gradient established by the V-type proton-pump ATPase to accumulate high concentrations of monoamines inside the vesicles prior to their release via exocytosis. Transports a variety of catecholamines such as dopamine, adrenaline and noradrenaline, histamine, and indolamines such as serotonin (PubMed:8643547, PubMed:23363473). Regulates the transvesicular monoaminergic gradient that determines the quantal size. Mediates somatodendritic dopamine release in hippocampal neurons, likely as part of a regulated secretory pathway that integrates retrograde synaptic signals (By similarity). Acts as a primary transporter for striatal dopamine loading ensuring impulse-dependent release of dopamine at the synaptic cleft (By similarity). Responsible for histamine and serotonin storage and subsequent corelease from mast cell granules (PubMed:8860238) (By similarity).
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
Ensembl ID | |||||
HGNC ID | |||||
Subcellular Location |
Cytoplasmic vesicle
Secretory vesicle
Synaptic vesicle membrane
Cytoplasmic vesicle
Secretory vesicle membrane
Cell projection
Axon
Cell projection
Dendrite
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000006 , HEK293
Clinical Information about the Protein
Target 1 ( Synaptic vesicle amine transporter (SLC18A2) )
Target Type | Successful Target | ||||
---|---|---|---|---|---|
Disease | 5 Target-related Diseases | 5 | |||
1 | Hypertension [ICD-11: BA00-BA04] | ||||
2 | Hyperkinetic movement disorder [ICD-11: 6B60.8] | ||||
3 | Movement disorder [ICD-11: 8A07-8A0Z] | ||||
4 | Tardive dyskinesia [ICD-11: 8A02.10] | ||||
5 | Substance use disorder [ICD-11: 6C4Z] | ||||
Approved Drug(s) | 3 Approved Drugs | 3 | |||
1 | Reserpine | Approved | |||
2 | Tetrabenazine | Approved | |||
3 | Ingrezza | Phase 4 | |||
Clinical Trial Drug(s) | 2 Clinical Trial Drugs | 2 | |||
1 | NBI-98854 | Phase 3 | |||
2 | Lobeline | Phase 2 |