General Information of the Protein
| Protein ID |
PT01817
|
||||
|---|---|---|---|---|---|
| Protein Name |
Translocator protein
|
||||
| Secondarily Protein Name |
Mitochondrial benzodiazepine receptor
PKBS
Peripheral-type benzodiazepine receptor
|
||||
| Gene Name |
TSPO
|
||||
| Secondarily Gene Name |
BZRP
MBR
|
||||
| Sequence |
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
Show/Hide
|
||||
| Organism |
Homo sapiens, Human
|
||||
| Protein Classification |
Membrane receptor
|
||||
| Function |
Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme (By similarity). Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism (PubMed:24814875), but its precise physiological role is controversial. It is apparently not required for steroid hormone biosynthesis. Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides (PubMed:1847678).
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Subcellular Location |
Mitochondrion membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000025 , HEK-293T
Cell Line ID: CL000006 , HEK293
Cell Line ID: CL000552 , T98G
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Translocator protein (TSPO) )
| Target Type | Successful Target | ||||
|---|---|---|---|---|---|
| Disease | 9 Target-related Diseases | 9 | |||
| 1 | Anxiety disorder [ICD-11: 6B00-6B0Z] | ||||
| 2 | Epilepsy [ICD-11: 8A60-8A68] | ||||
| 3 | Insomnia [ICD-11: 7A00-7A0Z] | ||||
| 4 | Benzodiazepine overdose [ICD-11: PC91] | ||||
| 5 | Irritability [ICD-11: MB24] | ||||
| 6 | Brain disease [ICD-11: 8C70-8E61] | ||||
| 7 | Rheumatoid arthritis [ICD-11: FA20] | ||||
| 8 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | ||||
| 9 | Gram-positive bacterial infection [ICD-11: 1B74-1G40] | ||||
| Approved Drug(s) | 17 Approved Drugs | 17 | |||
| 1 | Adinazolam | Approved | |||
| 2 | Alpidem | Approved | |||
| 3 | Alprazolam | Approved | |||
| 4 | Chlormezanone | Approved | |||
| 5 | Diazepam | Approved | |||
| 6 | Estazolam | Approved | |||
| 7 | Eszopiclone | Approved | |||
| 8 | Flumazenil | Approved | |||
| 9 | Flunitrazepam | Approved | |||
| 10 | Flurazepam | Approved | |||
| 11 | Halazepam | Approved | |||
| 12 | Lorazepam | Approved | |||
| 13 | Midazolam | Approved | |||
| 14 | Oxazepam | Approved | |||
| 15 | Prazepam | Approved | |||
| 16 | Temazepam | Approved | |||
| 17 | Triazolam | Approved | |||
| Clinical Trial Drug(s) | 3 Clinical Trial Drugs | 3 | |||
| 1 | 11C-PBR-28 | Phase 2 | |||
| 2 | SSR-180575 | Phase 2 | |||
| 3 | TLN-4601 | Phase 2 | |||
| Discontinued Drug(s) | 4 Discontinued Drugs | 4 | |||
| 1 | Ro-16-6028 | Discontinued in Phase 3 | |||
| 2 | Emapunil | Discontinued in Phase 2 | |||
| 3 | DAA-1097 | Terminated | |||
| 4 | Miltirone | Terminated | |||
| Investigative Drug(s) | 1 Investigative Drug | 1 | |||
| 1 | Ro 5-4864 | Investigative | |||