Protein Information

General Information of the Protein

Protein ID	PT01801
Protein Name	Leukotriene B4 receptor 1
Secondarily Protein Name	Chemoattractant receptor-like 1 G-protein coupled receptor 16 P2Y purinoceptor 7
Gene Name	LTB4R
Secondarily Gene Name	BLT BLT1 BLTR CMKRL1 GPR16 P2RY7
Sequence	MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Show/Hide
Organism	Homo sapiens, Human
Protein Classification	Membrane receptor > Family A G protein-coupled receptor > Small molecule receptor (family A GPCR) > Lipid-like ligand receptor (family A GPCR) > Leukotriene receptor
Function	Receptor for extracellular ATP > UTP and ADP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. May be the cardiac P2Y receptor involved in the regulation of cardiac muscle contraction through modulation of L-type calcium currents. Is a receptor for leukotriene B4, a potent chemoattractant involved in inflammation and immune response. Show/Hide
Uniprot ID	Primary ID: Q15722 Secondarily ID: Q13305 Q53XV5 Q92641 Q9BSU5 Show/Hide
Ensembl ID	ENSG00000213903
HGNC ID	HGNC:6713
Subcellular Location	Cell membrane

Map of Molecular Bioactivity Related to the Protein

Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity

Table of Molecular Bioactivities Related to the Protein

Cell Line ID: CL000006 , HEK293

Cell Line Info

Compound ID	Compound Name	Compound Formula
CP0046202 Compound Info	4-{2-(2-Carboxyethyl)-3-[6-([1,1',3,1'']terphenyl-5'-yloxy)-hexyl]phenoxy}butyric Acid Show/Hide	C37H40O6	1
1	IC50 = 38.5 nM Bioactivity Info	TI LI LO TS
CP0068053 Compound Info	4-{2-(2-Carboxy-ethyl)-3-[6-(3,5-di-pyridin-4-yl-phenoxy)-hexyl]-phenoxy}-butyric acid Show/Hide	C35H38N2O6	1
1	IC50 = 71 nM Bioactivity Info	TI LI LO TS
CP0093691 Compound Info	4-{3-[6-(3-5-Benzo[1,3]dioxolyl-5-thiophen-3-ylphenoxy)hexyl]-2-(2-carboxyethyl)phenoxy}butyric Acid Show/Hide	C36H38O8S	1
1	IC50 = 114 nM Bioactivity Info	TI LI LO TS
CP0068015 Compound Info	4-(3-(6-(5-(benzo[d][1,3]dioxol-5-yl)-3'-fluorobiphenyl-3-yloxy)hexyl)-2-(2-carboxyethyl)phenoxy)butanoic acid Show/Hide	C38H39FO8	1
1	IC50 = 129 nM Bioactivity Info	TI LI LO TS
CP0093685 Compound Info	4-(2-(2-carboxyethyl)-3-(6-(4,6-diphenylpyridin-2-yloxy)hexyl)phenoxy)butanoic acid Show/Hide	C36H39NO6	1
1	IC50 = 205 nM Bioactivity Info	TI LI LO TS

Cell Line Info

Cell Line Info

Biochemical Assays

Compound ID	Compound Name	Compound Formula
CP0044090 Compound Info	7-[3-(4-Acetyl-3-methoxy-2-propyl-phenoxy)-propoxy]-8-propyl-chroman-2-carboxylic acid Show/Hide	C28H36O7	6
1	IC50 = 1 nM
2	IC50 = 20 nM
3	IC50 = 43 nM
4	IC50 = 300 nM
5	IC50 = 320 nM
6	Ki = 280 nM
CP0041794 Compound Info	(E)-3-{3-(2-Carboxy-ethyl)-4-[6-(4-methoxy-phenyl)-hex-5-enyloxy]-benzoyl}-benzoic acid Show/Hide	C30H30O7	4
1	IC50 = 1.9 nM
2	IC50 = 12 nM
3	IC50 = 13 nM
4	IC50 = 13.2 nM

Clinical Information about the Protein

Target 1 ( Leukotriene B4 receptor 1 (LTB4R) )

Target Type	Clinical trial Target
Disease	9 Target-related Diseases				9
1	Human immunodeficiency virus infection [ICD-11: 1C62]
2	Rheumatoid arthritis [ICD-11: FA20]
3	Asthma [ICD-11: CA23]
4	Pancreatic cancer [ICD-11: 2C10]
5	Psoriasis vulgaris [ICD-11: EA90]
6	Kidney cancer [ICD-11: 2C90.0]
7	Inflammatory bowel disease [ICD-11: DD72]
8	Inflammation [ICD-11: 1A00-CA43.1]
9	Prostate cancer [ICD-11: 2C82.0]
Clinical Trial Drug(s)	2 Clinical Trial Drugs				2
1	LTB4	Drug Info	Phase 2	Human immunodeficiency virus infection
2	Biomed 101	Drug Info	Phase 1	Kidney cancer
Discontinued Drug(s)	13 Discontinued Drugs				13
1	CP-195543	Drug Info	Discontinued in Phase 2	Rheumatoid arthritis
2	LY-223982	Drug Info	Discontinued in Phase 2	Asthma
3	LY293111	Drug Info	Discontinued in Phase 2	Pancreatic cancer
4	SB-201993	Drug Info	Discontinued in Phase 2	Psoriasis vulgaris
5	CP-105696	Drug Info	Discontinued in Phase 1	Inflammatory bowel disease
6	LY-210073	Drug Info	Terminated	Asthma
7	LY-255283	Drug Info	Terminated	Asthma
8	RG-14893	Drug Info	Terminated	Asthma
9	Ro-25-4094	Drug Info	Terminated	Inflammation
10	RP-66153	Drug Info	Terminated	Asthma
11	SB-209247	Drug Info	Terminated	Psoriasis vulgaris
12	SC-53228	Drug Info	Terminated	Asthma
13	TAK-683	Drug Info	Discontinued in Phase 1	Prostate cancer