General Information of the Protein
| Protein ID |
PT01158
|
||||
|---|---|---|---|---|---|
| Protein Name |
Tyrosine-protein phosphatase non-receptor type 1
|
||||
| Secondarily Protein Name |
Protein-tyrosine phosphatase 1B
|
||||
| Gene Name |
PTPN1
|
||||
| Secondarily Gene Name |
PTP1B
|
||||
| Sequence |
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT
Show/Hide
|
||||
| Organism |
Homo sapiens, Human
|
||||
| Protein Classification |
Enzyme
>
Phosphatase
>
Protein Phosphatase
>
Tyrosine protein phosphatase
|
||||
| Function |
Tyrosine-protein phosphatase which acts as a regulator of endoplasmic reticulum unfolded protein response. Mediates dephosphorylation of EIF2AK3/PERK; inactivating the protein kinase activity of EIF2AK3/PERK. May play an important role in CKII- and p60c-src-induced signal transduction cascades. May regulate the EFNA5-EPHA3 signaling pathway which modulates cell reorganization and cell-cell repulsion. May also regulate the hepatocyte growth factor receptor signaling pathway through dephosphorylation of MET.
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Subcellular Location |
Endoplasmic reticulum membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000011 , CHO
Cell Line ID: CL000013 , Sf9
Biochemical Assays
Clinical Information about the Protein
Target 1 ( PTPN1 messenger RNA (PTPN1 mRNA) )
| Target Type | Successful Target | ||||
|---|---|---|---|---|---|
| Disease | 3 Target-related Diseases | 3 | |||
| 1 | Infectious disease [ICD-11: 1A00-CA43.1] | ||||
| 2 | Metabolic syndrome x [ICD-11: 5C50-5D2Z] | ||||
| 3 | Type-2 diabetes [ICD-11: 5A11] | ||||
| Approved Drug(s) | 1 Approved Drug | 1 | |||
| 1 | Hydrogen peroxide | Approved | |||
| Clinical Trial Drug(s) | 1 Clinical Trial Drug | 1 | |||
| 1 | URSOLIC ACID | Phase 2 | |||
| Discontinued Drug(s) | 1 Discontinued Drug | 1 | |||
| 1 | ERTIPROTAFIB | Terminated | |||
Target 2 ( Protein-tyrosine phosphatase 1B (PTP1B) )
| Target Type | Clinical trial Target | ||||
|---|---|---|---|---|---|
| Disease | 2 Target-related Diseases | 2 | |||
| 1 | Obesity [ICD-11: 5B81] | ||||
| 2 | Type-2 diabetes [ICD-11: 5A11] | ||||
| Clinical Trial Drug(s) | 1 Clinical Trial Drug | 1 | |||
| 1 | Trodusquemine | Phase 1 | |||
| Discontinued Drug(s) | 1 Discontinued Drug | 1 | |||
| 1 | JTT-551 | Terminated | |||
Similar Protein(s) and Bioactivity Statistics
50% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT02225 | Tyrosine-protein phosphatase non-receptor type 1 | Mus musculus, Mouse | |
|---|---|---|---|