General Information of the Protein
| Protein ID |
PT06643
|
||||
|---|---|---|---|---|---|
| Protein Name |
Ileal sodium/bile acid cotransporter
|
||||
| Secondarily Protein Name |
Apical sodium-dependent bile acid transporter
Ileal Na(+)/bile acid cotransporter
Ileal sodium-dependent bile acid transporter
Na(+)-dependent ileal bile acid transporter
Sodium/taurocholate cotransporting polypeptide
ileal
Solute carrier family 10 member 2
|
||||
| Gene Name |
SLC10A2
|
||||
| Secondarily Gene Name |
Ntcp2
|
||||
| Sequence |
MDNSSVCPPNATVCEGDSCVVPESNFNAILNTVMSTVLTILLAMVMFSMGCNVEVHKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVVVLIMGCCPGGTGSNILAYWIDGDMDLSVSMTTCSTLLALGMMPLCLFVYTKMWVDSGTIVIPYDSIGISLVALVIPVSFGMFVNHKWPQKAKIILKIGSITGVILIVLIAVIGGILYQSAWIIEPKLWIIGTIFPIAGYSLGFFLARLAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLNLVFTFPLIYTVFQLVFAAVILGIYVTYRKCYGKNDAEFLEKTDNEMDSRPSFDETNKGFQPDEK
Show/Hide
|
||||
| Organism |
Mus musculus, Mouse
|
||||
| Protein Classification |
Transporter
>
Electrochemical transporter
>
SLC superfamily of solute carriers
>
SLC10 family of sodium-bile acid co-transporters
|
||||
| Function |
Plays a critical role in the sodium-dependent reabsorption of bile acids from the lumen of the small intestine (PubMed:10101301). Transports various bile acids, unconjugated or conjugated, such as cholate and taurocholate (PubMed:10101301). Also responsible for bile acid transport in the renal proximal tubules, a salvage mechanism that helps conserve bile acids. Works collaboratively with the Na(+)-taurocholate cotransporting polypeptide (NTCP), the organic solute transporter (OST), and the bile salt export pump (BSEP), to ensure efficacious biological recycling of bile acids during enterohepatic circulation (By similarity).
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Ensembl ID | |||||
| Subcellular Location |
Membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000011 , CHO
Cell Line ID: CL000006 , HEK293
Similar Protein(s) and Bioactivity Statistics
90% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT06555 | Ileal sodium/bile acid cotransporter | Rattus norvegicus, Rat | |
|---|---|---|---|