General Information of the Protein
Protein ID |
PT06555
|
||||
---|---|---|---|---|---|
Protein Name |
Ileal sodium/bile acid cotransporter
|
||||
Secondarily Protein Name |
Apical sodium-dependent bile acid transporter
Ileal Na(+)/bile acid cotransporter
Ileal sodium-dependent bile acid transporter
Na(+)-dependent ileal bile acid transporter
Sodium/taurocholate-cotransporting polypeptide
ileal
Solute carrier family 10 member 2
|
||||
Gene Name |
SLC10A2
|
||||
Secondarily Gene Name |
Ntcp2
|
||||
Sequence |
MDNSSVCSPNATFCEGDSCLVTESNFNAILSTVMSTVLTILLAMVMFSMGCNVEINKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVVVLIMGCCPGGTGSNILAYWIDGDMDLSVSMTTCSTLLALGMMPLCLFIYTKMWVDSGTIVIPYDSIGISLVALVIPVSIGMFVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIEPKLWIIGTIFPIAGYSLGFFLARLAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLNLVFTFPLIYTVFQLVFAAIILGMYVTYKKCHGKNDAEFLEKTDNDMDPMPSFQETNKGFQPDEK
Show/Hide
|
||||
Organism |
Rattus norvegicus, Rat
|
||||
Protein Classification |
Transporter
>
Electrochemical transporter
>
SLC superfamily of solute carriers
>
SLC10 family of sodium-bile acid co-transporters
|
||||
Function |
Plays a critical role in the sodium-dependent reabsorption of bile acids from the lumen of the small intestine (PubMed:7860756). Transports various bile acids, unconjugated or conjugated, such as cholate and taurocholate. Also responsible for bile acid transport in the renal proximal tubules, a salvage mechanism that helps conserve bile acids. Works collaboratively with the Na(+)-taurocholate cotransporting polypeptide (NTCP), the organic solute transporter (OST), and the bile salt export pump (BSEP), to ensure efficacious biological recycling of bile acids during enterohepatic circulation (By similarity).
Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
Subcellular Location |
Membrane
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000006 , HEK293
Similar Protein(s) and Bioactivity Statistics
90% Identity
Protein ID | Protein Name | Protein Organism | |
PT06643 | Ileal sodium/bile acid cotransporter | Mus musculus, Mouse |
---|