General Information of the Protein
Protein ID |
PT06639
|
||||
---|---|---|---|---|---|
Protein Name |
C-C chemokine receptor type 5
|
||||
Gene Name |
CCR5
|
||||
Secondarily Gene Name |
CMKBR5
|
||||
Sequence |
MDYQVSSPTYDIDYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKRLKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSSHFPYSQYQFWKNFQTLKMVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Show/Hide
|
||||
Organism |
Macaca fascicularis, Crab-eating macaque, Cynomolgus monkey
|
||||
Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Peptide receptor (family A GPCR)
>
Chemokine receptor
>
CC chemokine receptor
|
||||
Function |
Receptor for a number of inflammatory CC-chemokines including CCL3/MIP-1-alpha, CCL4/MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Participates in T-lymphocyte migration to the infection site by acting as a chemotactic receptor.
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
Subcellular Location |
Cell membrane
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000011 , CHO
Similar Protein(s) and Bioactivity Statistics
100% Identity
Protein ID | Protein Name | Protein Organism | |
PT04523 | C-C chemokine receptor type 5 | Macaca mulatta, Rhesus macaque |
---|
90% Identity
Protein ID | Protein Name | Protein Organism | |
PT00903 | C-C chemokine receptor type 5 | Homo sapiens, Human |
---|
50% Identity
Protein ID | Protein Name | Protein Organism | |
PT05087 | C-C chemokine receptor type 5 | Mus musculus, Mouse |
---|