General Information of the Protein
| Protein ID |
PT06639
|
||||
|---|---|---|---|---|---|
| Protein Name |
C-C chemokine receptor type 5
|
||||
| Gene Name |
CCR5
|
||||
| Secondarily Gene Name |
CMKBR5
|
||||
| Sequence |
MDYQVSSPTYDIDYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKRLKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSSHFPYSQYQFWKNFQTLKMVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Show/Hide
|
||||
| Organism |
Macaca fascicularis, Crab-eating macaque, Cynomolgus monkey
|
||||
| Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Peptide receptor (family A GPCR)
>
Chemokine receptor
>
CC chemokine receptor
|
||||
| Function |
Receptor for a number of inflammatory CC-chemokines including CCL3/MIP-1-alpha, CCL4/MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Participates in T-lymphocyte migration to the infection site by acting as a chemotactic receptor.
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Subcellular Location |
Cell membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000011 , CHO
Similar Protein(s) and Bioactivity Statistics
100% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT04523 | C-C chemokine receptor type 5 | Macaca mulatta, Rhesus macaque | |
|---|---|---|---|
90% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT00903 | C-C chemokine receptor type 5 | Homo sapiens, Human | |
|---|---|---|---|
50% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT05087 | C-C chemokine receptor type 5 | Mus musculus, Mouse | |
|---|---|---|---|