General Information of the Protein
| Protein ID |
PT06171
|
||||
|---|---|---|---|---|---|
| Protein Name |
G-protein coupled receptor homolog US28
|
||||
| Secondarily Protein Name |
HHRF3
|
||||
| Gene Name |
US28
|
||||
| Sequence |
MTPTTTTAELTTEFDYDEDATPCVFTDVLNQSKPVTLFLYGVVFLFGSIGNFLVIFTITWRRRIQCSGDVYFINLAAADLLFVCTLPLWMQYLLDHNSLASVPCTLLTACFYVAMFASLCFITEIALDRYYAIVYMRYRPVKQACLFSIFWWIFAVIIAIPHFMVVTKKDNQCMTDYDYLEVSYPIILNVELMLGAFVIPLSVISYCYYRISRIVAVSQSRHKGRIVRVLIAVVLVFIIFWLPYHLTLFVDTLKLLKWISSSCEFERSLKRALILTESLAFCHCCLNPLLYVFVGTKFRQELHCLLAEFRQRLFSRDVSWYHSMSFSRRSSPSRRETSSDTLSDEVCRVSQIIP
Show/Hide
|
||||
| Organism |
Human cytomegalovirus (strain AD169), HHV-5, Human herpesvirus 5
|
||||
| Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Peptide receptor (family A GPCR)
>
Chemokine receptor
>
CC chemokine receptor
|
||||
| Function |
Binds to a great number of different CC-chemokines including CCL5/RANTES, CCL2/MCP-1, CCL3/MIP-1-alpha as well as CX3CL1/Fractalkine (PubMed:7961796, PubMed:25745166, PubMed:7540006). Transduces signals resulting in the activation of MAP kinase signaling pathways and augmentation of intracellular calcium ion levels, leading to alterations in chemotactic behavior of vascular smooth muscle cells and macrophages. The US28 receptor also exhibits high levels of agonist-independent signaling activity and agonist-independent endocytosis (PubMed:11050102, PubMed:25745166). Interacts with the host Gi complex without activating it, thereby probably interfering with the chemokine-Gi signaling (PubMed:35061538). May also function as a G protein sink to sequester G protein from the cell surface via internalization (PubMed:35061538). Interacts with endogenous Gaq/11 subunits and thereby constitutively activates phospholipase C (PubMed:11050102).
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Subcellular Location |
Host cell membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000053 , COS-7