General Information of the Protein
| Protein ID |
PT06045
|
||||
|---|---|---|---|---|---|
| Protein Name |
Folate receptor beta
|
||||
| Secondarily Protein Name |
Folate receptor 2
Folate receptor
fetal/placental
Placental folate-binding protein
|
||||
| Gene Name |
FOLR2
|
||||
| Sequence |
MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNAGEMLHGTGGLLLSLALMLQLWLLG
Show/Hide
|
||||
| Organism |
Homo sapiens, Human
|
||||
| Protein Classification |
Membrane receptor
|
||||
| Function |
Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release.
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| HGNC ID | |||||
| Subcellular Location |
Cell membrane
Secreted
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000330 , CHO Pro-4 MtxRII OuaR-2-4
Cell Line ID: CL000344 , D4 [Mouse hybridoma against human RICTOR]
Cell Line ID: CL000853 , HeLa R1-11
Clinical Information about the Protein
Target 1 ( Folate receptor beta (FOLR2) )
| Target Type | Literature-reported Target | ||||
|---|---|---|---|---|---|