General Information of the Protein
Protein ID |
PT05456
|
||||
---|---|---|---|---|---|
Protein Name |
Orexin/Hypocretin receptor type 1
|
||||
Secondarily Protein Name |
Hypocretin receptor type 1
Orexin receptor type 1
|
||||
Gene Name |
HCRTR1
|
||||
Sequence |
MEPSATPGAQPGVPTSSGEPFHLPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFLIALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGQALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAVMVPQAAVMECSSVLPELANRTRLFSVCDEHWADELYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSEQLEAQHQGLCTEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPGSSARHKSLSLQSRCSVSKVSEHVVLTTVTTVLS
Show/Hide
|
||||
Organism |
Mus musculus, Mouse
|
||||
Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Peptide receptor (family A GPCR)
>
Short peptide receptor (family A GPCR)
>
Orexin receptor
|
||||
Function |
Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding.
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
Ensembl ID | |||||
Subcellular Location |
Cell membrane
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000011 , CHO
Similar Protein(s) and Bioactivity Statistics
90% Identity
Protein ID | Protein Name | Protein Organism | |
PT03559 | Orexin/Hypocretin receptor type 1 | Rattus norvegicus, Rat |
---|
50% Identity
Protein ID | Protein Name | Protein Organism | |
PT05830 | Orexin receptor type 2 | Mus musculus, Mouse |
---|