General Information of the Protein
| Protein ID |
PT03559
|
||||
|---|---|---|---|---|---|
| Protein Name |
Orexin/Hypocretin receptor type 1
|
||||
| Secondarily Protein Name |
Hypocretin receptor type 1
Orexin receptor type 1
|
||||
| Gene Name |
HCRTR1
|
||||
| Sequence |
MEPSATPGAQPGVPTSSGEPFHLPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFLIALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAVMVPQAAVMECSSVLPELANRTRLFSVCDERWADELYPKIYHSCFFFVTYLAPLGLMGMAYFQIFRKLWGPQIPGTTSALVRNWKRPSEQLEAQHQGLCTEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPSSSARHKSLSLQSRCSVSKVSEHVVLTTVTTVLS
Show/Hide
|
||||
| Organism |
Rattus norvegicus, Rat
|
||||
| Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Peptide receptor (family A GPCR)
>
Short peptide receptor (family A GPCR)
>
Orexin receptor
|
||||
| Function |
Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding.
Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| Subcellular Location |
Cell membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000011 , CHO
Similar Protein(s) and Bioactivity Statistics
90% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT05456 | Orexin/Hypocretin receptor type 1 | Mus musculus, Mouse | |
|---|---|---|---|
50% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT05830 | Orexin receptor type 2 | Mus musculus, Mouse | |
|---|---|---|---|