General Information of the Protein
Protein ID |
PT05155
|
||||
---|---|---|---|---|---|
Protein Name |
Nuclear receptor subfamily 4 group A member 2
|
||||
Secondarily Protein Name |
Immediate-early response protein NOT
Orphan nuclear receptor NURR1
Transcriptionally-inducible nuclear receptor
|
||||
Gene Name |
NR4A2
|
||||
Secondarily Gene Name |
NOT
NURR1
TINUR
|
||||
Sequence |
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Show/Hide
|
||||
Organism |
Homo sapiens, Human
|
||||
Protein Classification |
Transcription factor
>
Nuclear receptor
>
Nuclear hormone receptor subfamily 4
>
Nuclear hormone receptor subfamily 4 group A
>
Nuclear hormone receptor subfamily 4 group A member 2
|
||||
Function |
Transcriptional regulator which is important for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development (PubMed:17184956, PubMed:15716272). It is crucial for expression of a set of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons (By similarity).
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
Ensembl ID | |||||
HGNC ID | |||||
Subcellular Location |
Cytoplasm
Nucleus
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000011 , CHO
Cell Line ID: CL000025 , HEK-293T
Cell Line ID: CL000473 , MN9D
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Orphan nuclear receptor NURR1 (NR4A2) )
Target Type | Literature-reported Target |
---|
Similar Protein(s) and Bioactivity Statistics
50% Identity
Protein ID | Protein Name | Protein Organism | |
PT06794 | Nuclear receptor subfamily 4 group A member 2 | Mus musculus, Mouse |
---|