General Information of the Protein
Protein ID |
PT05020
|
||||
---|---|---|---|---|---|
Protein Name |
Adenosine receptor A1
|
||||
Gene Name |
ADORA1
|
||||
Sequence |
MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVTQRRAAVAIAGCWILSLVVGLTPMFGWNNLSEVEQAWIANGSVGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFLKIWNDHFRCQPKPPIEEDIPEEKADD
Show/Hide
|
||||
Organism |
Mus musculus, Mouse
|
||||
Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Small molecule receptor (family A GPCR)
>
Nucleotide-like receptor (family A GPCR)
>
Adenosine receptor
|
||||
Function |
Receptor for adenosine. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase.
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
Subcellular Location |
Cell membrane
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000011 , CHO
Similar Protein(s) and Bioactivity Statistics
90% Identity
Protein ID | Protein Name | Protein Organism | |
PT01717 | Adenosine receptor A1 | Rattus norvegicus, Rat |
---|
50% Identity
Protein ID | Protein Name | Protein Organism | |
PT00840 | Adenosine receptor A1 | Homo sapiens, Human |
---|