General Information of the Protein
| Protein ID |
PT04975
|
||||
|---|---|---|---|---|---|
| Protein Name |
G-protein coupled bile acid receptor 1
|
||||
| Secondarily Protein Name |
Membrane-type receptor for bile acids
|
||||
| Gene Name |
GPBAR1
|
||||
| Secondarily Gene Name |
Tgr5
|
||||
| Sequence |
MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN
Show/Hide
|
||||
| Organism |
Mus musculus, Mouse
|
||||
| Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Small molecule receptor (family A GPCR)
>
Lipid-like ligand receptor (family A GPCR)
>
Steroid-like ligand receptor
|
||||
| Function |
Receptor for bile acid. Bile acid-binding induces its internalization, activation of extracellular signal-regulated kinase and intracellular cAMP production. May be involved in the suppression of macrophage functions by bile acids (By similarity). Involved in bile acid promoted GLP1R secretion.
Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| Subcellular Location |
Cell membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000011 , CHO
Cell Line ID: CL000026 , CHO-K1
Cell Line ID: CL000025 , HEK-293T
Cell Line ID: CL000006 , HEK293
Cell Line ID: CL000001 , Jurkat
Cell Line ID: CL000851 , STC 1
Similar Protein(s) and Bioactivity Statistics
90% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT06776 | G-protein coupled bile acid receptor 1 | Rattus norvegicus, Rat | |
|---|---|---|---|
50% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT02509 | G-protein coupled bile acid receptor 1 | Homo sapiens, Human | |
|---|---|---|---|