General Information of the Protein
Protein ID |
PT04823
|
||||
---|---|---|---|---|---|
Protein Name |
Adenosine receptor A2b
|
||||
Gene Name |
ADORA2B
|
||||
Sequence |
MQLETQDALYVALELVIAALAVAGNVLVCAAVGASSALQTPTNYFLVSLATADVAVGLFAIPFAITISLGFCTDFHGCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKGLVTGTRARGIIAVLWVLAFGIGLTPFLGWNSKDSATSNCTELGDGIANKSCCPVTCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFMVACKQLQRMELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAINCITLFHPALAKDKPKWVMNVAILLSHANSVVNPIVYAYRNRDFRYSFHKIISRYVLCQAETKGGSGQAGAQSTLSLGL
Show/Hide
|
||||
Organism |
Mus musculus, Mouse
|
||||
Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Small molecule receptor (family A GPCR)
>
Nucleotide-like receptor (family A GPCR)
>
Adenosine receptor
|
||||
Function |
Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
Subcellular Location |
Cell membrane
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000011 , CHO
Cell Line ID: CL000006 , HEK293
Biochemical Assays
Compound ID | Compound Name | Compound Formula | |
CP0069838 |
(4-Cyano-phenyl)-carbamic acid 4-(2,6-dioxo-1,3-dipropyl-2,3,6,7-tetrahydro-1H-purin-8-yl)-phenyl ester
Show/Hide
|
C26H26N6O4
|
1 |
1 | Ki = 3.39 nM |
---|
Similar Protein(s) and Bioactivity Statistics
90% Identity
Protein ID | Protein Name | Protein Organism | |
PT02131 | Adenosine receptor A2b | Rattus norvegicus, Rat |
---|
50% Identity
Protein ID | Protein Name | Protein Organism | |
PT01278 | Adenosine receptor A2b | Homo sapiens, Human |
---|