General Information of the Protein
| Protein ID |
PT03540
|
||||
|---|---|---|---|---|---|
| Protein Name |
G protein-coupled receptor 88
|
||||
| Secondarily Protein Name |
Striatum-specific G-protein coupled receptor
|
||||
| Gene Name |
GPR88
|
||||
| Secondarily Gene Name |
STRG
|
||||
| Sequence |
MTNSSSTSTSSTTGGSLLLLCEEEESWAGRRIPVSLLYSGLAIGGTLANGMVIYLVSSFRKLQTTSNAFIVNGCAADLSVCALWMPQEAVLGLLPTGSAEPPADWDGAGGSYRLLRGGLLGLGLTVSLLSHCLVALNRYLLITRAPATYQALYQRRHTAGMLALSWALALGLVLLLPPWAPRPGAAPPRVHYPALLAAAALLAQTALLLHCYLGIVRRVRVSVKRVSVLNFHLLHQLPGCAAAAAAFPGAQHAPGPGGAAHPAQAQPLPPALHPRRAQRRLSGLSVLLLCCVFLLATQPLVWVSLASGFSLPVPWGVQAASWLLCCALSALNPLLYTWRNEEFRRSVRSVLPGVGDAAAAAVAATAVPAVSQAQLGTRAAGQHW
Show/Hide
|
||||
| Organism |
Homo sapiens, Human
|
||||
| Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
|
||||
| Function |
Orphan G protein-coupled receptor implicated in a large repertoire of behavioral responses that engage motor activities, spatial learning, and emotional processing (By similarity). May play a role in the regulation of cognitive and motor function (By similarity). Couples with the heterotrimeric G protein complex of the G(i) subfamily, consisting of GNAI1, GNB1 and GNG2, thereby acting through a G(i)-mediated pathway (PubMed:35501348). Plays a role in the attenuation of D1 dopamine receptor (D1R)-mediated cAMP response in ciliated cells (PubMed:23936473). In non-ciliated cells, involved in the inhibition of the beta-2 adrenergic receptor (B2AR) response (PubMed:23936473).
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| HGNC ID | |||||
| Subcellular Location |
Cell membrane
Cell projection
Cilium membrane
Cytoplasm
Nucleus
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000011 , CHO
Cell Line ID: CL000025 , HEK-293T
Cell Line ID: CL000006 , HEK293
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Striatum-specific G-protein coupled receptor (GPR88) )
| Target Type | Literature-reported Target | ||||
|---|---|---|---|---|---|