General Information of the Protein
Protein ID |
PT03048
|
||||
---|---|---|---|---|---|
Protein Name |
C-C chemokine receptor type 1
|
||||
Secondarily Protein Name |
Macrophage inflammatory protein 1-alpha receptor
RANTES-R
|
||||
Gene Name |
CCR1
|
||||
Secondarily Gene Name |
Cmkbr1
|
||||
Sequence |
MEISDFTEAYPTTTEFDYGDSTPCQKTAVRAFGAGLLPPLYSLVFIIGVVGNVLVILVLMQHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDAMCKLLSGFYYLGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPALYFFKAQWEFTHRTCSPHFPYKSLKQWKRFQALKLNLLGLILPLLVMIICYAGIIRILLRRPSEKKVKAVRLIFAITLLFFLLWTPYNLSVFVSAFQDVLFTNQCEQSKQLDLAMQVTEVIAYTHCCVNPIIYVFVGERFWKYLRQLFQRHVAIPLAKWLPFLSVDQLERTSSISPSTGEHELSAGF
Show/Hide
|
||||
Organism |
Mus musculus, Mouse
|
||||
Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Peptide receptor (family A GPCR)
>
Chemokine receptor
>
CC chemokine receptor
|
||||
Function |
Receptor for a C-C type chemokine. Binds to MIP-1-alpha, RANTES, and less efficiently, to MIP-1-beta or MCP-1 and subsequently transduces a signal by increasing the intracellular calcium ions level. Responsible for affecting stem cell proliferation.
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
Subcellular Location |
Cell membrane
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000026 , CHO-K1
Cell Line ID: CL000534 , WEHI-274.1
Biochemical Assays
Similar Protein(s) and Bioactivity Statistics
50% Identity
Protein ID | Protein Name | Protein Organism | |
PT01070 | C-C chemokine receptor type 1 | Homo sapiens, Human | |
---|---|---|---|
PT04322 | Probable C-C chemokine receptor type 3 | Mus musculus, Mouse | |
PT05277 | C-C chemokine receptor type 3 | Rattus norvegicus, Rat |