General Information of the Protein
Protein ID |
PT02296
|
||||
---|---|---|---|---|---|
Protein Name |
Cholecystokinin receptor type A
|
||||
Secondarily Protein Name |
Cholecystokinin-1 receptor
|
||||
Gene Name |
CCKAR
|
||||
Sequence |
MDVVDSLLMNGSNITPPCELGLENETLFCLDQPQPSKEWQSAVQILLYSFIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICRPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPSDAMQQSWQTFLLLILFLIPGVVMVVAYGLISLELYQGIKFDASQKKSAKEKRLSSGGGGGGGSSSSRYEDSDGCYLQKSRPPRKLELQQLSTSSSGGRINRIRSSGSAANLIAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAEKHLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPTGVRGEVGEEEDGRTIRASLSRYSYSHMSTSAPPH
Show/Hide
|
||||
Organism |
Mus musculus, Mouse
|
||||
Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Peptide receptor (family A GPCR)
>
Short peptide receptor (family A GPCR)
>
Cholecystokinin receptor
|
||||
Function |
Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system (By similarity).
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
Subcellular Location |
Cell membrane
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000386 , Flp-In-CHO
Similar Protein(s) and Bioactivity Statistics
50% Identity
Protein ID | Protein Name | Protein Organism | |
PT00958 | Cholecystokinin receptor type A | Homo sapiens, Human | |
---|---|---|---|
PT01365 | Cholecystokinin receptor type A | Rattus norvegicus, Rat |