General Information of the Protein
| Protein ID |
PT02079
|
||||
|---|---|---|---|---|---|
| Protein Name |
Gonadotropin-releasing hormone receptor
|
||||
| Gene Name |
GNRHR
|
||||
| Sequence |
VAFATSFTVCWTPYYVLGIWYWFDPEMLNRVSDPVNHFFFLFAFLNPCFDPLIYGYFSL
Show/Hide
|
||||
| Organism |
Macaca mulatta, Rhesus macaque
|
||||
| Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Peptide receptor (family A GPCR)
>
Short peptide receptor (family A GPCR)
>
GnRH receptor
|
||||
| Function |
Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system.
Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| Subcellular Location |
Cell membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000011 , CHO
Cell Line ID: CL000006 , HEK293
Biochemical Assays
Similar Protein(s) and Bioactivity Statistics
50% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT01836 | Gonadotropin-releasing hormone receptor | Homo sapiens, Human | |
|---|---|---|---|
| PT01997 | Gonadotropin-releasing hormone receptor | Rattus norvegicus, Rat | |