General Information of the Protein
| Protein ID |
PT01986
|
||||
|---|---|---|---|---|---|
| Protein Name |
B1 bradykinin receptor
|
||||
| Gene Name |
BDKRB1
|
||||
| Sequence |
MASQGPLELQPSNQSQLAPPNATSCSGAPDAWDLLHRLLPTFIIAIFTLGLLGNSFVLSVFLLARRRLSVAEIYLANLAASDLVFVLGLPFWAENVRNQFDWPFGAALCRIVNGVIKANLFISIFLVVAISQDRYSVLVHPMASRRGRRRRQAQATCALIWLAGGLLSTPTFVLRSVRAVPELNVSACILLLPHEAWHWLRMVELNLLGFLLPLAAILFFNCHILASLRRRGERVPSRCGGPRDSKSTALILTLVASFLVCWAPYHFFAFLECLWQVHAIGGCFWEEFTDLGLQLSNFSAFVNSCLNPVIYVFVGRLFRTKVWELCQQCSPRSLAPVSSSRRKEMLWGFWRN
Show/Hide
|
||||
| Organism |
Oryctolagus cuniculus, Rabbit
|
||||
| Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Peptide receptor (family A GPCR)
>
Short peptide receptor (family A GPCR)
>
Bradykinin receptor
|
||||
| Function |
This is a receptor for bradykinin. Could be a factor in chronic pain and inflammation.
Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| Subcellular Location |
Cell membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000389 , CHO-DXB11
Cell Line ID: CL000011 , CHO
Similar Protein(s) and Bioactivity Statistics
50% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT02677 | B1 bradykinin receptor | Rattus norvegicus, Rat | |
|---|---|---|---|
| PT05747 | B1 bradykinin receptor | Canis lupus familiaris, Dog, Canis familiaris | |