General Information of the Protein
Protein ID |
PT01986
|
||||
---|---|---|---|---|---|
Protein Name |
B1 bradykinin receptor
|
||||
Gene Name |
BDKRB1
|
||||
Sequence |
MASQGPLELQPSNQSQLAPPNATSCSGAPDAWDLLHRLLPTFIIAIFTLGLLGNSFVLSVFLLARRRLSVAEIYLANLAASDLVFVLGLPFWAENVRNQFDWPFGAALCRIVNGVIKANLFISIFLVVAISQDRYSVLVHPMASRRGRRRRQAQATCALIWLAGGLLSTPTFVLRSVRAVPELNVSACILLLPHEAWHWLRMVELNLLGFLLPLAAILFFNCHILASLRRRGERVPSRCGGPRDSKSTALILTLVASFLVCWAPYHFFAFLECLWQVHAIGGCFWEEFTDLGLQLSNFSAFVNSCLNPVIYVFVGRLFRTKVWELCQQCSPRSLAPVSSSRRKEMLWGFWRN
Show/Hide
|
||||
Organism |
Oryctolagus cuniculus, Rabbit
|
||||
Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Peptide receptor (family A GPCR)
>
Short peptide receptor (family A GPCR)
>
Bradykinin receptor
|
||||
Function |
This is a receptor for bradykinin. Could be a factor in chronic pain and inflammation.
Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
Subcellular Location |
Cell membrane
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000389 , CHO-DXB11
Cell Line ID: CL000011 , CHO
Similar Protein(s) and Bioactivity Statistics
50% Identity
Protein ID | Protein Name | Protein Organism | |
PT02677 | B1 bradykinin receptor | Rattus norvegicus, Rat | |
---|---|---|---|
PT05747 | B1 bradykinin receptor | Canis lupus familiaris, Dog, Canis familiaris |