General Information of the Protein
Protein ID |
PT01516
|
||||
---|---|---|---|---|---|
Protein Name |
Muscarinic acetylcholine receptor M5
|
||||
Gene Name |
CHRM5
|
||||
Sequence |
MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
Show/Hide
|
||||
Organism |
Homo sapiens, Human
|
||||
Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Small molecule receptor (family A GPCR)
>
Monoamine receptor
>
Acetylcholine receptor
|
||||
Function |
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
Ensembl ID | |||||
HGNC ID | |||||
Subcellular Location |
Cell membrane
Postsynaptic cell membrane
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000398 , A-9
Cell Line ID: CL000051 , BHK-21
Cell Line ID: CL000011 , CHO
Cell Line ID: CL000026 , CHO-K1
Cell Line ID: CL000845 , CHO-K9
Cell Line ID: CL000035 , NIH 3T3
Cell Line ID: CL000013 , Sf9
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Muscarinic acetylcholine receptor M5 (CHRM5) )
Target Type | Successful Target | ||||
---|---|---|---|---|---|
Disease | 18 Target-related Diseases | 18 | |||
1 | Glaucoma/ocular hypertension [ICD-11: 9C61] | ||||
2 | Organophosphate poisoning [ICD-11: NE6Z] | ||||
3 | Urinary retention [ICD-11: MF50.3] | ||||
4 | Amnesia [ICD-11: MB21.1] | ||||
5 | Examination of eyes or vision [ICD-11: QA00.6] | ||||
6 | Suprapubic pain [ICD-11: MG30-MG3Z] | ||||
7 | Gastrointestinal disease [ICD-11: DE2Z] | ||||
8 | Irritable bowel syndrome [ICD-11: DD91.0] | ||||
9 | Gastritis [ICD-11: DA42] | ||||
10 | Peptic ulcer [ICD-11: DA61] | ||||
11 | Parkinson disease [ICD-11: 8A00.0] | ||||
12 | Psychomotor agitation [ICD-11: MB23.M] | ||||
13 | Urinary incontinence [ICD-11: MF50.2] | ||||
14 | Chronic obstructive pulmonary disease [ICD-11: CA22] | ||||
15 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | ||||
16 | Depression [ICD-11: 6A70-6A7Z] | ||||
17 | Alzheimer disease [ICD-11: 8A20] | ||||
18 | Attention deficit hyperactivity disorder [ICD-11: 6A05.Z] | ||||
Approved Drug(s) | 16 Approved Drugs | 16 | |||
1 | ACECLIDINE | Approved | |||
2 | Atropine | Approved | |||
3 | Bethanechol | Approved | |||
4 | Choline alfoscerate | Approved | |||
5 | Cyclopentolate | Approved | |||
6 | Flavoxate | Approved | |||
7 | Hyoscyamine | Approved | |||
8 | Mebeverine | Approved | |||
9 | Mepenzolate | Approved | |||
10 | Methantheline | Approved | |||
11 | Oxyphencyclimine | Approved | |||
12 | Pilocarpine | Approved | |||
13 | Procyclidine | Approved | |||
14 | Promazine | Approved | |||
15 | Propiverine | Approved | |||
16 | Umeclidinium | Approved | |||
Clinical Trial Drug(s) | 1 Clinical Trial Drug | 1 | |||
1 | L-651582 | Phase 3 | |||
Discontinued Drug(s) | 2 Discontinued Drugs | 2 | |||
1 | Benactyzine | Withdrawn from market | |||
2 | RS 86 | Terminated | |||
Investigative Drug(s) | 1 Investigative Drug | 1 | |||
1 | PF-3409409 | Investigative |
Similar Protein(s) and Bioactivity Statistics
50% Identity
Protein ID | Protein Name | Protein Organism | |
PT03292 | Muscarinic acetylcholine receptor M5 | Rattus norvegicus, Rat |
---|