General Information of the Protein
| Protein ID |
PT01216
|
||||
|---|---|---|---|---|---|
| Protein Name |
Apoptosis regulator Bcl-2
|
||||
| Gene Name |
BCL2
|
||||
| Sequence |
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Show/Hide
|
||||
| Organism |
Homo sapiens, Human
|
||||
| Protein Classification |
Ion channel
>
Other ion channel
>
Miscellaneous ion channel
>
Bcl-2 family
|
||||
| Function |
Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells (PubMed:1508712, PubMed:8183370). Regulates cell death by controlling the mitochondrial membrane permeability (PubMed:11368354). Appears to function in a feedback loop system with caspases (PubMed:11368354). Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1) (PubMed:11368354). Also acts as an inhibitor of autophagy: interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function (PubMed:18570871, PubMed:21358617, PubMed:20889974). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release (PubMed:17418785).
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Subcellular Location |
Mitochondrion outer membrane
Nucleus membrane
Endoplasmic reticulum membrane
Cytoplasm
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000121 , FDC-P1
Cell Line ID: CL000001 , Jurkat
Cell Line ID: CL000048 , PC-3
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Apoptosis regulator Bcl-2 (BCL-2) )
| Target Type | Successful Target | ||||
|---|---|---|---|---|---|
| Disease | 6 Target-related Diseases | 6 | |||
| 1 | Chronic lymphocytic leukaemia [ICD-11: 2A82.0] | ||||
| 2 | Amyotrophic lateral sclerosis [ICD-11: 8B60.0] | ||||
| 3 | Polycystic ovarian syndrome [ICD-11: 5A80.1] | ||||
| 4 | Myelofibrosis [ICD-11: 2A20.2] | ||||
| 5 | Prostate cancer [ICD-11: 2C82.0] | ||||
| 6 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | ||||
| Approved Drug(s) | 3 Approved Drugs | 3 | |||
| 1 | GDC-0199 | Approved | |||
| 2 | MCI-186 | Approved | |||
| 3 | Taxol | Approved | |||
| Clinical Trial Drug(s) | 3 Clinical Trial Drugs | 3 | |||
| 1 | Thymoquinone | Phase 2/3 | |||
| 2 | ABT-263 | Phase 3 | |||
| 3 | Gossypol | Phase 2 | |||
| Investigative Drug(s) | 1 Investigative Drug | 1 | |||
| 1 | Apogossypol | Investigative | |||
Target 2 ( BCL-2 messenger RNA (BCL2 mRNA) )
| Target Type | Clinical trial Target | ||||
|---|---|---|---|---|---|