General Information of the Protein
Protein ID |
PT01043
|
||||
---|---|---|---|---|---|
Protein Name |
Urokinase-type plasminogen activator
|
||||
Gene Name |
PLAU
|
||||
Sequence |
MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
Show/Hide
|
||||
Organism |
Homo sapiens, Human
|
||||
Protein Classification |
Enzyme
>
Protease
>
Serine protease
>
Serine protease PA clan
>
Serine protease S1A subfamily
|
||||
Function |
Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
Ensembl ID | |||||
HGNC ID | |||||
Subcellular Location |
Secreted
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000006 , HEK293
Cell Line ID: CL000265 , NS0
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Urokinase-type plasminogen activator (PLAU) )
Target Type | Successful Target | ||||
---|---|---|---|---|---|
Disease | 4 Target-related Diseases | 4 | |||
1 | Breast cancer [ICD-11: 2C60-2C65] | ||||
2 | Reperfusion injury [ICD-11: ND56.Z] | ||||
3 | Myocardial hypertrophy [ICD-11: BC45] | ||||
4 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | ||||
Clinical Trial Drug(s) | 3 Clinical Trial Drugs | 3 | |||
1 | Upamostat | Phase 2 | |||
2 | PMID18163548C4 | Clinical trial | |||
3 | UK-356202 | Clinical trial | |||
Discontinued Drug(s) | 2 Discontinued Drugs | 2 | |||
1 | WX-UK1 | Discontinued in Phase 1/2 | |||
2 | B-428 | Terminated |