General Information of the Protein
| Protein ID |
PT00708
|
||||
|---|---|---|---|---|---|
| Protein Name |
Sodium/hydrogen exchanger isoform 3
|
||||
| Gene Name |
NHE3
|
||||
| Sequence |
KYVKANISEQSATTVRYTMKMLASGAETIIFMFLGISAVDPLIWKWNTAFVLLTLVFISVYRVIGVVLQTWILNRYRMVQLEIIDQVVMSYGGLRGAVAFALVVLLDENKVKEKNLFVSTTLIVIFFTVIVQGLTIKPLV
Show/Hide
|
||||
| Organism |
Sus scrofa, Pig
|
||||
| Protein Classification |
Unclassified protein
|
||||
| Uniprot ID | |||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Similar Protein(s) and Bioactivity Statistics
50% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT03762 | Sodium/hydrogen exchanger 3 | Homo sapiens, Human | |
|---|---|---|---|