General Information of the Protein
Protein ID |
PT00624
|
||||
---|---|---|---|---|---|
Protein Name |
G protein-coupled receptor GPR35
|
||||
Gene Name |
GPR35
|
||||
Secondarily Gene Name |
GPR35
|
||||
Sequence |
MNNTNCSILPWPAAVNHIFTIYLVLLLVLGLLLNGLALWVFCYRMHQWTETRVYMTNLAVADVCLLCSLPFVLYSLKYSTSDTPICQLSQGIYLVNRYMSISLVTAIAVDRYVAVRHPLRARELRSPRQAGAVCVALWVIVVTSLVLRWRLGIQEGGFCFSSQNRYNFSTTAFSLLGFYLPLAIVVFCSLQVVTALARRPATDVEQVEATQKATRMVWANLAVFIICFLPLHLILTVQVSLNLHTCAARNIFSRALTITAKLSDINCCLDAICYYYMAKEFQDASLRATASSTPHKSQDTQSLSLT
Show/Hide
|
||||
Organism |
Rattus norvegicus, Rat
|
||||
Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Small molecule receptor (family A GPCR)
>
Carboxylic acid receptor
>
Kynurenic acid receptor
|
||||
Uniprot ID | |||||
Subcellular Location |
Membrane
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000011 , CHO
Cell Line ID: CL000006 , HEK293
Similar Protein(s) and Bioactivity Statistics
50% Identity
Protein ID | Protein Name | Protein Organism | |
PT06259 | G-protein coupled receptor 35 | Mus musculus, Mouse |
---|