General Information of the Protein
| Protein ID |
PT00619
|
||||
|---|---|---|---|---|---|
| Protein Name |
11-beta-hydroxysteroid dehydrogenase 1
|
||||
| Secondarily Protein Name |
7-oxosteroid reductase
Corticosteroid 11-beta-dehydrogenase isozyme 1
|
||||
| Gene Name |
HSD11B1
|
||||
| Sequence |
MAFKKKYLPPLLGFFLAYYYYSANEEFRPEMLQGKKVIVTGASKGIGEQMAYHLAKMGAHVVVTARSKETLKKVVSHCLELGAASAHYIPGTMEDMTFAEQFVAKAGKLMGGLDMLILNHITNTSMNLFSGDIHLVRRSMEVNFLSYVVLSAAALPMLKQSNGSIVVVSSKAGKMSSPLVAPYSASKFALDGFFSSVRMEHSVTKVNVSITLCILGLINTDTAMKAVSGILSTVGASSKEECALEIIKGGALRQEEVYYDNSVWTAFLLGNPGRKILEFLSLRSYKLDKFINN
Show/Hide
|
||||
| Organism |
Canis lupus familiaris, Dog, Canis familiaris
|
||||
| Protein Classification |
Enzyme
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| Subcellular Location |
Endoplasmic reticulum membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Similar Protein(s) and Bioactivity Statistics
50% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT01107 | 11-beta-hydroxysteroid dehydrogenase 1 | Homo sapiens, Human | |
|---|---|---|---|
| PT01109 | 11-beta-hydroxysteroid dehydrogenase 1 | Mus musculus, Mouse | |
| PT03061 | 11-beta-hydroxysteroid dehydrogenase 1 | Rattus norvegicus, Rat | |