Protein Information

General Information of the Protein

Protein ID	PT06765
Protein Name	Hepcidin
Secondarily Protein Name	Liver-expressed antimicrobial peptide 1 Putative liver tumor regressor
Gene Name	HAMP
Secondarily Gene Name	HEPC LEAP1 UNQ487/PRO1003
Sequence	MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT Show/Hide
Organism	Homo sapiens, Human
Protein Classification	Secreted protein
Function	Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues. Acts by promoting endocytosis and degradation of ferroportin/SLC40A1, leading to the retention of iron in iron-exporting cells and decreased flow of iron into plasma (PubMed:22682227, PubMed:29237594, PubMed:32814342). Controls the major flows of iron into plasma: absorption of dietary iron in the intestine, recycling of iron by macrophages, which phagocytose old erythrocytes and other cells, and mobilization of stored iron from hepatocytes (PubMed:22306005). Show/Hide
Uniprot ID	Primary ID: P81172 Secondarily ID: Q1HE14 Q9BY68 Show/Hide
HGNC ID	HGNC:15598
Subcellular Location	Secreted

Map of Molecular Bioactivity Related to the Protein

Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity

Table of Molecular Bioactivities Related to the Protein

Cell Line ID: CL000148 , Huh-7

Cell Line Info

Compound ID	Compound Name	Compound Formula
CP0967056 Compound Info	methyl(3R,5S)-3,5-dimethyl-4-[3-[6-[(3R)-3-methylpiperazin-1-yl]-3-pyridyl]-1H-pyrazolo[4,3-d]pyrimidin-5-yl]piperazine-1-carboxylate Show/Hide	C23H31N9O2	1
1	IC50 = 7.3 nM Bioactivity Info	TI LI LO TS
CP0950697 Compound Info	[(3R,5S)-3,5-dimethyl-4-[3-[6-[(3R)-3-methylpiperazin-1-yl]-3-pyridyl]-1H-pyrazolo[4,3-d]pyrimidin-5-yl]piperazin-1-yl]-pyrrolidin-1-yl-methanone Show/Hide	C26H36N10O	1
1	IC50 = 28 nM Bioactivity Info	TI LI LO TS
CP0970051 Compound Info	methyl(3R,5S)-3,5-dimethyl-4-[3-[4-(4-methylpiperazin-1-yl)phenyl]-1H-pyrazolo[4,3-d]pyrimidin-5-yl]piperazine-1-carboxylate Show/Hide	C24H32N8O2	1
1	IC50 = 34 nM Bioactivity Info	TI LI LO TS
CP0965080 Compound Info	methyl(3R,5S)-3,5-dimethyl-4-[3-[6-(4-methylpiperazin-1-yl)-3-pyridyl]-1H-pyrazolo[4,3-d]pyrimidin-5-yl]piperazine-1-carboxylate Show/Hide	C23H31N9O2	1
1	IC50 = 58 nM Bioactivity Info	TI LI LO TS

Cell Line Info

Clinical Information about the Protein

Target 1 ( Hepcidin (HAMP) )

Target Type	Clinical trial Target

Target 2 ( Hepcidin messenger RNA (HAMP mRNA) )

Target Type	Literature-reported Target