General Information of the Protein
| Protein ID |
PT06422
|
||||
|---|---|---|---|---|---|
| Protein Name |
Trace amine-associated receptor 1
|
||||
| Gene Name |
TAAR1
|
||||
| Secondarily Gene Name |
TA1
TAR1
TRAR1
|
||||
| Sequence |
MPFCHNIINISCVKNNWSNDVRASLYSLMALIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKINILVVCVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLAFMTSFYIPGSIMLCIYYRIYLIAKEQARSINDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFVCTVIDPFLHYTIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMILFGKIFQKDSSRCKLFLESSS
Show/Hide
|
||||
| Organism |
Macaca mulatta, Rhesus macaque
|
||||
| Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Small molecule receptor (family A GPCR)
>
Monoamine receptor
>
Trace amine receptor
|
||||
| Function |
Receptor for trace amines, including beta-phenylethylamine (b-PEA), p-tyramine (p-TYR), octopamine and tryptamine, with highest affinity for b-PEA and p-TYR. Unresponsive to classical biogenic amines, such as epinephrine and histamine and only partially activated by dopamine and serotonin. Trace amines are biogenic amines present in very low levels in mammalian tissues. Although some trace amines have clearly defined roles as neurotransmitters in invertebrates, the extent to which they function as true neurotransmitters in vertebrates has remained speculative. Trace amines are likely to be involved in a variety of physiological functions that have yet to be fully understood. The signal transduced by this receptor is mediated by the G(s)-class of G-proteins which activate adenylate cyclase (By similarity).
Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| Subcellular Location |
Cell membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000076 , CHO/Galpha16