General Information of the Protein
| Protein ID |
PT06160
|
||||
|---|---|---|---|---|---|
| Protein Name |
Neuropeptides B/W receptor type 1
|
||||
| Secondarily Protein Name |
G-protein coupled receptor 7
|
||||
| Gene Name |
NPBWR1
|
||||
| Secondarily Gene Name |
GPR7
|
||||
| Sequence |
MDNASFSEPWPANASGPDPALSCSNASTLAPLPAPLAVAVPVVYAVICAVGLAGNSAVLYVLLRAPRMKTVTNLFILNLAIADELFTLVLPINIADFLLRQWPFGELMCKLIVAIDQYNTFSSLYFLTVMSADRYLVVLATAESRRVAGRTYSAARAVSLAVWGIVTLVVLPFAVFARLDDEQGRRQCVLVFPQPEAFWWRASRLYTLVLGFAIPVSTICVLYTTLLCRLHAMRLDSHAKALERAKKRVTFLVVAILAVCLLCWTPYHLSTVVALTTDLPQTPLVIAISYFITSLSYANSCLNPFLYAFLDASFRRNLRQLITCRAAA
Show/Hide
|
||||
| Organism |
Homo sapiens, Human
|
||||
| Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Peptide receptor (family A GPCR)
>
Short peptide receptor (family A GPCR)
>
Neuropeptide receptor
|
||||
| Function |
Interacts specifically with a number of opioid ligands. Receptor for neuropeptides B and W, which may be involved in neuroendocrine system regulation, food intake and the organization of other signals. Has a higher affinity for neuropeptide B.
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| HGNC ID | |||||
| Subcellular Location |
Cell membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000026 , CHO-K1
Cell Line ID: CL000011 , CHO
Cell Line ID: CL000076 , CHO/Galpha16
Cell Line ID: CL000025 , HEK-293T
Cell Line ID: CL000006 , HEK293
Similar Protein(s) and Bioactivity Statistics
50% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT06379 | Neuropeptides B/W receptor type 1 | Mus musculus, Mouse | |
|---|---|---|---|