General Information of the Protein
Protein ID |
PT05673
|
||||
---|---|---|---|---|---|
Protein Name |
Cystine/glutamate transporter
|
||||
Secondarily Protein Name |
Amino acid transport system xc-
Calcium channel blocker resistance protein CCBR1
Solute carrier family 7 member 11
xCT
|
||||
Gene Name |
SLC7A11
|
||||
Sequence |
MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL
Show/Hide
|
||||
Organism |
Homo sapiens, Human
|
||||
Protein Classification |
Transporter
>
Electrochemical transporter
>
SLC superfamily of solute carriers
>
SLC03 and SLC07 families of heteromeric amino acid transporters (HATs)
>
SLC07 Cationic amino acid transporter/glycoprotein-associated family
|
||||
Function |
Heterodimer with SLC3A2, that functions as an antiporter by mediating the exchange of extracellular anionic L-cystine and intracellular L-glutamate across the cellular plasma membrane (PubMed:15151999, PubMed:34880232, PubMed:35352032, PubMed:35245456, PubMed:11417227, PubMed:14722095, PubMed:11133847). Provides L-cystine for the maintenance of the redox balance between extracellular L-cystine and L-cysteine and for the maintenance of the intracellular levels of glutathione that is essential for cells protection from oxidative stress (By similarity). The transport is sodium-independent, electroneutral with a stoichiometry of 1:1, and is drove by the high intracellular concentration of L-glutamate and the intracellular reduction of L-cystine (PubMed:11417227, PubMed:11133847). In addition, mediates the import of L-kynurenine leading to anti-ferroptotic signaling propagation required to maintain L-cystine and glutathione homeostasis (PubMed:35245456). Moreover, mediates N-acetyl-L-cysteine uptake into the placenta leading to subsequently down-regulation of pathways associated with oxidative stress, inflammation and apoptosis (PubMed:34120018). In vitro can also transport L-aspartate (PubMed:11417227). May participate in astrocyte and meningeal cell proliferation during development and can provide neuroprotection by promoting glutathione synthesis and delivery from non-neuronal cells such as astrocytes and meningeal cells to immature neurons (By similarity). Controls the production of pheomelanin pigment directly (By similarity).
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
HGNC ID | |||||
Subcellular Location |
Cell membrane
Cell projection
Microvillus membrane
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000579 , CCF-STTG1
Cell Line ID: CL000102 , U-87MG ATCC
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Cystine/glutamate transporter (SLC7A11) )
Target Type | Clinical trial Target |
---|