General Information of the Protein
| Protein ID |
PT05640
|
||||
|---|---|---|---|---|---|
| Protein Name |
Lysophosphatidic acid receptor 4
|
||||
| Secondarily Protein Name |
G-protein coupled receptor 23
P2Y purinoceptor 9
P2Y5-like receptor
Purinergic receptor 9
|
||||
| Gene Name |
LPAR4
|
||||
| Secondarily Gene Name |
GPR23
LPA4
P2RY9
|
||||
| Sequence |
MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVSLFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLTNIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLATLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF
Show/Hide
|
||||
| Organism |
Homo sapiens, Human
|
||||
| Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Small molecule receptor (family A GPCR)
>
Lipid-like ligand receptor (family A GPCR)
>
EDG receptor
|
||||
| Function |
Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. Transduces a signal by increasing the intracellular calcium ions and by stimulating adenylyl cyclase activity. The rank order of potency for agonists of this receptor is 1-oleoyl- > 1-stearoyl- > 1-palmitoyl- > 1-myristoyl- > 1-alkyl- > 1-alkenyl-LPA.
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Subcellular Location |
Cell membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000555 , B103
Cell Line ID: CL000011 , CHO
Clinical Information about the Protein
Target 1 ( Lysophosphatidic acid receptor 4 (LPAR4) )
| Target Type | Literature-reported Target | ||||
|---|---|---|---|---|---|
Similar Protein(s) and Bioactivity Statistics
90% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT06693 | Lysophosphatidic acid receptor 4 | Mus musculus, Mouse | |
|---|---|---|---|