General Information of the Protein
Protein ID |
PT04205
|
||||
---|---|---|---|---|---|
Protein Name |
Transcription factor Jun
|
||||
Secondarily Protein Name |
Activator protein 1
Proto-oncogene c-Jun
Transcription factor AP-1 subunit Jun
V-jun avian sarcoma virus 17 oncogene homolog
p39
|
||||
Gene Name |
JUN
|
||||
Sequence |
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Show/Hide
|
||||
Organism |
Homo sapiens, Human
|
||||
Protein Classification |
Transcription factor
|
||||
Function |
Transcription factor that recognizes and binds to the AP-1 consensus motif 5'-TGA[GC]TCA-3' (PubMed:10995748, PubMed:22083952). Heterodimerizes with proteins of the FOS family to form an AP-1 transcription complex, thereby enhancing its DNA binding activity to the AP-1 consensus sequence 5'-TGA[GC]TCA-3' and enhancing its transcriptional activity (By similarity). Together with FOSB, plays a role in activation-induced cell death of T cells by binding to the AP-1 promoter site of FASLG/CD95L, and inducing its transcription in response to activation of the TCR/CD3 signaling pathway (PubMed:12618758). Promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation (PubMed:17210646). Involved in activated KRAS-mediated transcriptional activation of USP28 in colorectal cancer (CRC) cells (PubMed:24623306). Binds to the USP28 promoter in colorectal cancer (CRC) cells (PubMed:24623306).
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
Ensembl ID | |||||
HGNC ID | |||||
Subcellular Location |
Nucleus
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000068 , A-549
Cell Line ID: CL000006 , HEK293
Cell Line ID: CL000063 , Hep-G2
Cell Line ID: CL000001 , Jurkat
Cell Line ID: CL000035 , NIH 3T3
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Transcription factor AP-1 (JUN) )
Target Type | Discontinued Target | ||||
---|---|---|---|---|---|
Disease | 1 Target-related Disease | 1 | |||
1 | Rheumatoid arthritis [ICD-11: FA20] | ||||
Discontinued Drug(s) | 1 Discontinued Drug | 1 | |||
1 | T-5224 | Discontinued in Phase 2 |
Target 2 ( c-Jun messenger RNA (c-Jun mRNA) )
Target Type | Literature-reported Target |
---|